KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01976Help
Entry
ECL_01976         CDS       T01231                                 

Definition
(RefSeq) histidine kinase
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HAMP HATPase_c_5 HATPase_c_2
Motif
Other DBs
NCBI-GeneID: 9124471
NCBI-ProteinID: YP_003612477
UniProt: A0A0H3CLU2
Position
complement(2012848..2014143)
Genome map
AA seq 431 aa AA seqDB search
MRIWPRSLLTRLLIIVMLGLLLANALSLTLVMLERMRSARTVMLGNLEYDVSTSVAILDR
LPAKERPAWLERLARGNYRYILGTGEPGPAPHDKRSQDAIRTLTEALSATWPLTFTAVPG
PVSHIQAHLTLSDGSPLTIDLIPRMPPVASWLPVVLVLQLLLLAFCSWIAVRQVIRPFSQ
FTRAVDSLDPAASSPMTEAGPVEVQRAAHAFNAMQARIQSYLRERAQILASVSHDLQTPI
TRMKLRVEMADQPELRDKLLNDLDNMTRLVREGIAYARSSESLEETSLKLELNAWINSIA
SDYQDIGKNVQLQATDARLPVVTRPQALRRVMTNLLDNALKFGDYAVITIHSDAHHVTIA
IRDGGPGIPDAELEAVLQPFYRVETSRNRDTGGTGLGLAIAAQLTAQLGGKLHLANHAEG
GLDVSITLPRG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaggatctggccacgctcgttactgacgcgactgctgatcatcgtgatgctggggctc
ctgctggccaacgcgctcagcctcacgctggtcatgcttgagcgaatgcgcagcgcccgc
acggtgatgctcggcaacctggaatatgacgtttccaccagtgtggccatcctcgaccgg
cttcccgcaaaggagcgtccagcctggctggaacgactggcgcgggggaactatcgctac
attctgggcaccggcgaaccggggcctgcaccgcatgacaaacgctcgcaggatgccatc
cgcaccctgacagaggcgctgtcggcaacctggccactgacgtttactgccgtgccgggg
ccggtttcccatattcaggcccaccttacgctgagcgatggttcgccgctgaccattgac
cttatcccccgaatgcctccggtcgccagctggctgcctgtagtgcttgtgttgcagcta
ctgcttctggcgttctgctcatggattgccgtgcgtcaggttattcgacccttttctcag
tttacccgggcggtggattccctcgacccggcagcaagctcgccaatgaccgaggcaggg
ccagtcgaggtgcaacgggccgcgcacgcctttaatgccatgcaggcgcgtatccagtct
tacctgcgcgagcgtgcgcagatcctggcctccgtatcgcacgaccttcagaccccgata
acgcgcatgaagttacgcgtcgaaatggcggaccagccggaactgcgggacaagttgctc
aacgacctggacaatatgacgcgcctggtgcgggaaggaatagcgtatgcccggtcatca
gaatctctggaagagacctcgctcaagctggagttgaatgcctggataaacagcatcgcc
agcgattaccaggacatcgggaaaaacgtgcagcttcaggcaaccgatgcccgtctgccc
gtggtcacgcgtccgcaggcgctacgccgggtgatgaccaatctgctggataatgcgctg
aaatttggcgactacgccgtcattacgattcattcagatgcccatcatgttacgatcgct
attcgcgatggggggccggggataccggacgccgaactggaggcggtattgcagccgttt
tatcgggtggaaacctcacgaaaccgcgacaccgggggcaccggattagggctagcaatc
gccgcccagttgactgcgcagttaggcgggaaattgcatctggcgaaccacgccgagggt
gggctggacgtttcgattacgctgccgcgcgggtaa

DBGET integrated database retrieval system