KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01980Help
Entry
ECL_01980         CDS       T01231                                 

Definition
(RefSeq) N-acetyltransferase GCN5
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_CG Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 9124475
NCBI-ProteinID: YP_003612481
UniProt: A0A0H3CK59
Position
complement(2016519..2016989)
Genome map
AA seq 156 aa AA seqDB search
MTLRKAHPQEAEILWNIRKQAIRHGCKTSYDADVIARWTPDDMPEHYRQMVIEYPFYVVE
DEKGDIAATGYLDLDTHCLEAIFTLPAASGKGMATRIIEALKQEAHSRGLTRLTLDATPN
ARSFYQKLGFVTLSEKYHHSRMAGADLRCFEMAINL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacgaaaagcacatccgcaggaagctgaaatactctggaatattcgcaagcag
gcgattcgtcacggctgtaaaaccagttacgacgcggacgtcattgcgcgctggacgccc
gacgacatgccggagcattaccggcaaatggtcattgaataccctttttacgtggtggaa
gatgaaaagggcgacattgcggcaactggctatcttgatctggatacccactgtctggag
gcgatattcaccttgccggcggcatccggaaaaggcatggcgacccggattatcgaggcg
ctcaaacaggaggcacatagccgggggttaacccgcctgacgctcgatgcaacgcctaac
gcccggtcgttttaccagaagctggggtttgtcacgctgagcgaaaagtatcatcactcg
cgcatggcgggcgctgatttacgctgttttgaaatggcgatcaacttgtaa

DBGET integrated database retrieval system