KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01981Help
Entry
ECL_01981         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 9124476
NCBI-ProteinID: YP_003612482
UniProt: A0A0H3CLU6
Position
complement(2016999..2017586)
Genome map
AA seq 195 aa AA seqDB search
MRLWSLLTGRVFQDLLQHGKEIEEAIARRDTRVLNHSTPELEGYFSRPLSELPRQNPYPV
AALLPLFLVAFALNLLPFLSALQGLSPLHHALSFFAPSLIMTGALIVISVLLARGVTSGL
LGFMAVFIILLVITLVQVLHLLFSHSGNLWPLVTASFALILCRMVMNSSGFVLFTLYCRT
QRLARVAHEIRLKSH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgtggtctcttttaaccggacgtgttttccaggatctcctgcagcatggcaaa
gagatagaggaggccattgctcgtcgtgatacccgtgttttgaatcattccacccccgag
ctggaagggtatttttctcgccccctcagcgagcttccgcgtcaaaatccttacccggta
gcggcgctgttacctctttttttagtggcgtttgcgttaaaccttctgccttttctcagc
gcgttgcagggtttgtcacctttacaccatgcactgagctttttcgcaccatcattaata
atgacaggcgcgctcattgttatcagcgtgcttctggcccgaggggtaacgtcaggattg
ttggggtttatggcagtgttcatcattctgctggtcataactctcgttcaggttctgcat
cttctgttttctcatagcggaaacctttggccactggtcaccgcatccttcgcgctgata
ctttgtcggatggtaatgaatagcagcggctttgtgctgtttaccctctattgtcgcact
cagcgtcttgccagagttgcacatgaaatccggttaaaaagccattaa

DBGET integrated database retrieval system