KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01993Help
Entry
ECL_01993         CDS       T01231                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 9124488
NCBI-ProteinID: YP_003612494
UniProt: A0A0H3CIV0
Position
2029829..2030707
Genome map
AA seq 292 aa AA seqDB search
MDLTQLEMFNAVALTGSITQAAQKVHRVPSNLTTRIRQLEADLGVELFIRESQRLRLSPA
GHNFLRYSKQILALVDEARMVVAGDEPQGLFALGALESTAAVRIPESLAAFNQRYPRIQF
ALSTGPSGTMIDGVLEGTLSAAFVDGPLSHPELEGMPVYREEMMLVTPAGHAEVTRAAQV
SGSDVYAFRANCSYRRHLESWFHADRATPGRIHEMESYHGMLACVIAGAGIALMPRSMLE
SMPGHHQVEAWPLAENWRWLTTWLVWRRGAMTRQLEAFIALLNERRQPEPSP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatttaactcagcttgaaatgtttaacgccgttgccctgaccggcagcattacccag
gcggcgcagaaagtgcatcgcgttccgtctaacctcaccacccgcatccgccagcttgag
gccgatctcggcgttgagttgtttatccgggagagccagcgtttgcgcttatctcccgcc
gggcacaactttctgcgctacagcaagcagatcctggcgctggttgacgaggcgcgcatg
gtcgtcgccggtgatgagccgcaggggttatttgcccttggcgccctggagagcaccgcc
gccgtgcggatcccggaaagtctggcggcgtttaaccagcgctatccgcgcattcagttc
gcgctctctaccggcccgtccggaacgatgattgacggcgttctggaaggcaccttaagc
gcggcgtttgtcgacgggccactttcacacccggagctggaaggcatgccggtttaccgg
gaagagatgatgctggtcacccccgccggacatgcggaggtgacgcgcgccgcgcaggta
agcggcagcgacgtctacgcgtttcgcgcaaactgttcgtatcgacgtcatctggaaagc
tggtttcacgcagaccgcgccacgcccgggcggatccatgagatggagtcgtatcacggt
atgctcgcctgcgtgattgcaggggcgggtattgcgctaatgccccgctccatgctggag
agcatgccggggcatcatcaggtagaggcgtggccgctggcggagaactggcgctggctg
accacctggctggtgtggcgtcgtggggcgatgacccgccagctcgaagcgtttatagcg
ctgctaaacgaacgtcgacaaccagagccttctccataa

DBGET integrated database retrieval system