KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01998Help
Entry
ECL_01998         CDS       T01231                                 

Definition
(RefSeq) putative alcohol dehydrogenase
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 9124493
NCBI-ProteinID: YP_003612499
UniProt: A0A0H3CIV4
Position
2034359..2035507
Genome map
AA seq 382 aa AA seqDB search
MVTLNSTIISGANALAAIRPLLTENAQLLLVTDGNIARLEAATQIRSILEEGNRRVTVID
TVPPEPSHHDVSQLLAGLNSGSFDVVVGIGGGSVLDVAKLLSVLCHPLSPGLDSLLAGVK
PVARISSLLIPATAGTGSEATPNAILAIPEQNTKVGIISPVLLPDYVALLPELTTSMPAH
IASSTGIDALCHLIECFTATVANPVSDNAALTGLAKLLKNIETACAEPGNLLAKLEMLWA
SYYGGVAIAHAGTHLVHALSYPLGGKYHLPHGVANAILLAPCMRVVRPHCVTKFAQVWDL
VPGADGSLSDDEKSHALVEYFAALVRRLNLPDNLESLGVPREDIASLSDAALNVKRLMNN
APCQVNHDEVQAIYRTLFPEHA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggttaccctcaacagcaccattattagcggcgcaaatgcgctcgccgccatcaggcca
ttactcaccgaaaacgcgcagctcttgctggttacggacggcaacattgcgcgtctggag
gcggcaacacagatccgttcaattcttgaagagggcaaccgccgcgtcacggtgattgac
acggtgccgcctgaaccctcccaccacgatgtcagccagttgctcgcgggattaaacagc
ggatcgtttgatgtcgtggttgggatcggcggcggcagcgtactggatgtggcgaaactg
ctctccgtgctttgtcacccgctgtcaccggggctggacagcctgctggcaggggtaaaa
ccggtggcacgcatctcctcacttctgatccccgccaccgccggaaccgggtcagaagcc
acgccgaacgctattctggcgataccggagcaaaacacgaaggtcggtattatctctccg
gtcctgctgcccgattacgtcgccctgctgccggaattgaccaccagcatgcccgcgcat
attgcctcctccaccggcatcgatgccctgtgccatctgattgagtgcttcaccgccacg
gtcgccaacccggtcagcgataacgcggcgttgaccgggctcgctaagctgctgaagaac
atcgaaacggcctgcgctgagccgggcaacctgctggcaaagctggaaatgctgtgggcc
tcttattacggcggggtcgcgattgcgcatgccggcacacacctggttcacgccctgtct
tatccgcttggcgggaaatatcacctgccgcacggcgtggccaacgccattcttctggcg
ccctgcatgagggtggttcgtccccactgcgtgacaaaatttgcgcaggtctgggatctc
gtgccaggcgcggacggcagcctgtccgatgacgaaaaatctcacgcgctggtggagtac
tttgccgcgctggttcgtcggctcaacctgccggacaaccttgagtccctgggcgtgccg
cgcgaagacatcgcttccctgagcgatgccgccctgaacgttaaacggttaatgaacaat
gccccctgtcaggtgaatcacgacgaggtgcaggcgatttatcggacactgtttcctgaa
catgcatag

DBGET integrated database retrieval system