KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02001Help
Entry
ECL_02001         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_4 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 9124496
NCBI-ProteinID: YP_003612502
UniProt: A0A0H3CLW4
Position
2037897..2039060
Genome map
AA seq 387 aa AA seqDB search
MSVTVTRDGIIRPQQDTRVEAAMLPSACPQNHAANLLPLPDGSLMCVWFGGTQEGIADIS
VWGSRLSPGSQQWSEAEKLSDDATRSEQNPVLFLAPDNVLWLLWTAQISGNQDTAIVRYR
QSRDLGKTWGDIATLLDKPGTFIRQPIVVLENGNWLLPVFYCRTRPGEKWVGNDDISAVK
ISEDGGKTWRDVEVPDSLGCVHMNITPLRNGTLVALFRSRWADNIYYSQSTDNGESWSVP
EPTVLPNNNSSIQVTTLASGELALVFNLMSAAGAQERRTSLYDEIDDGDGRKEPVVTHGR
AAFWGAPRAPMTVAISPDGGKSWPWQRHLDEGDGYCMTNNSLEKLNREFSYPSIKQSPDG
SLHIAYTYFRQAIKYVRVTPEWVKESA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaccgtaacccgcgacgggattattcgcccacaacaggatacgcgcgtggag
gcggccatgctgccttccgcctgcccacaaaaccacgcggcaaatctgctgccgctgccg
gatggttcgctgatgtgcgtctggtttggcggtacccaggagggtattgcggatatctct
gtgtggggttcgcgcctgtcaccgggaagccagcagtggagtgaggcagaaaaactgtcg
gatgatgccacgcgctctgaacagaacccggttctgttcctggcacccgataacgtgctg
tggctgctgtggaccgcgcaaatttccggcaaccaggacaccgctattgtgcgctatcgc
cagtcccgggatctgggtaaaacctggggggacatcgcgaccctgctcgataaacccggc
acctttattcgtcagccgattgtcgtgctggagaacgggaactggctgctgccggtgttt
tactgccgcacccggccgggtgagaaatgggtcggtaacgatgacatcagcgcggtgaaa
atctccgaagacgggggcaaaacctggcgtgatgtcgaggtgccggacagcctgggctgc
gtccatatgaatatcaccccgctgcgcaatggcaccctggttgccctgttccgcagccgc
tgggcggataacatttattacagccagtcaacggacaacggcgaaagctggtccgtgccg
gaacccacggtattacctaacaacaactcctctatccaggtgacaacgcttgccagtggc
gagctggcgctggtgtttaacctcatgagcgccgccggggcgcaggagcgtcgcacctcg
ctgtacgatgaaattgacgatggcgatggccgtaaagagccggttgtaacccacggtcgg
gccgccttctggggtgccccgcgtgcgccgatgaccgtcgccatttcgccggacggaggc
aaaagctggccgtggcaacggcatctggacgagggagatggctactgcatgactaacaac
tctctggagaaactgaaccgtgagttttcctatccgagcattaagcagagcccggatggc
agcctgcatatcgcctacacctactttcgtcaggccataaaatacgtgcgggtgacgccc
gagtgggtcaaggagtcagcatga

DBGET integrated database retrieval system