KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02009Help
Entry
ECL_02009         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
  KO
K13630  multiple antibiotic resistance protein MarB
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    ECL_02009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarB
Motif
Other DBs
NCBI-GeneID: 9124504
NCBI-ProteinID: YP_003612510
UniProt: A0A0H3CJU9
Position
2045053..2045271
Genome map
AA seq 72 aa AA seqDB search
MNVTASAALALLVLFSSQTFAEQPPRATQQNNHDTMILPSAHSQSPYDFNHMGSGSDKSD
ELGVPYYNQHGF
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttaccgcctccgccgccctcgccttgctggtgctcttttccagccagaccttc
gcggagcaaccccctcgtgcaacgcagcaaaataatcatgacacgatgattttgccgtca
gcacatagccagtccccttatgatttcaaccacatggggtctggtagcgacaaatccgac
gaattaggcgtgccttattataatcagcacggcttctga

DBGET integrated database retrieval system