KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02012Help
Entry
ECL_02012         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZinT
Motif
Other DBs
NCBI-GeneID: 9124507
NCBI-ProteinID: YP_003612513
UniProt: A0A0H3CI70
Position
complement(2047666..2048304)
Genome map
AA seq 212 aa AA seqDB search
MAAHIGKFAMTLGALLVSGQLFAHSHGHQMTEAEQKAANGVFADKDVKDRKLSDWDGTWQ
SVYPFLLDGSLDPVFRKKAQKDNKTFDEIKAYYRTGYATDVEAIGIENNVMEFHKGKEVS
RCQYDYSGYKILTYASGKKGVRYLFECKDAGSKAPKFVQFSDHTIAPKASSHFHIFMGNT
SHEALLKEMDNWPTYYPNEMYKEQVVEEMLHH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcacatattggaaaatttgcgatgactctgggggcgctgctggtcagcggccag
ctgtttgcccactcacacggtcaccagatgaccgaagcggagcaaaaggcggcaaacggc
gtgtttgcggacaaagacgttaaggaccggaaactgtccgactgggacggcacctggcag
tccgtttatcccttcctgctggatggctcgctggatccggtcttcagaaagaaggcgcag
aaggacaataaaacgttcgacgagattaaagcctattaccgcacggggtacgccaccgat
gtggaagctatcggcatcgaaaataacgtcatggaatttcataaaggtaaagaggtcagc
cgctgtcagtatgattatagcggctacaaaattctgacctacgcgtcaggcaaaaaaggc
gttcgctatctgtttgagtgtaaggacgcgggcagcaaggcaccgaagtttgttcagttc
agcgaccacaccattgcgccaaaagcctcatcccacttccacatctttatgggcaatacc
tcccacgaggcactgctgaaagagatggataactggccgacctattatccaaacgagatg
tacaaagagcaggtggtggaggagatgctgcaccactag

DBGET integrated database retrieval system