KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02016Help
Entry
ECL_02016         CDS       T01231                                 

Gene name
livH
Definition
(RefSeq) branched-chain amino acid transport system permease
  KO
K11960  urea transport system permease protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02010  ABC transporters
Module
enc_M00323  Urea transport system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECL_02016 (livH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_02016 (livH)
Transporters [BR:enc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Urea transporter [MD:M00323] [OT]
    ECL_02016 (livH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 HEAT_2 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 9124511
NCBI-ProteinID: YP_003612517
UniProt: A0A0H3CLY0
Position
complement(2050936..2052510)
Genome map
AA seq 524 aa AA seqDB search
MNAMRMMIAIVWLTGLLPGMAQASDADQFVAASRSQQADMLTRWALAPDAARLPLLQALQ
NENLFADSQKHAFARRNGEMVALGDSPAAEGQTKAVRLTNRLRVLAATANATHQLISDNV
TQRRAAARQLQRDAQPEMIGLLQTRVSSETDDVARQSLLLALANLQLASPQADVRLQAIE
RLGQSDDPDVPSRLMPYTQTQTEPDARVRAAAGESLSQIQHRLMWGDLLGQAFMGLSLGS
VLLLAALGLAITYGLLGVINMAHGEMLMLGAYATWMVQQIMASVTPQWLALYPVVALPVA
FCLTAGIGMILERTVIRHLYGRPLETLLATWGISLMLIQLVRMTFGAQNLEVANPAWLSG
GVQVFANLTLPWNRIVVLGFVLMVLFFTWLVLNKTRLGLNVRAVTQNRSMAACCGVPTGR
VDMLAFGLGSGIAGLGGVALSQLGNVGPELGQGYIIDSFLVVVLGGVGQLAGSVAAAFGL
GIFNKILEPQMGAVLGKIVILVAIILFIQKRPQGLFALKGRVTD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatgcgcatgatgatcgctattgtatggcttaccgggctgctgccagggatg
gcgcaggcatcggatgccgatcaatttgttgccgccagccgcagccagcaggcggatatg
ctgacccgctgggctctcgcgccggatgccgcaagactgccgttactgcaggcgctgcaa
aacgaaaatctgtttgccgacagccagaaacatgcctttgcgcgacgcaatggcgagatg
gtggcgctgggagattcccctgctgcagaagggcaaaccaaagccgtacgcctgaccaac
cgtctgcgggtgctggccgccacggccaacgctacgcatcagcttatcagtgacaacgtc
acgcagcggcgtgccgccgcgcgccagttacagcgggatgcgcagccggaaatgatcggc
ctcctgcaaacgcgggtaagcagtgaaacggacgatgtggcgcgccagtcgctgctgctg
gcgctggctaatctccagctcgccagcccacaggctgacgtgcgtcttcaggctattgaa
cggctcgggcaatctgacgacccggacgtgccatcccgactcatgccatatacccagacg
caaaccgaaccggatgcccgcgtacgtgccgccgccggggagagcctgagccaaattcag
caccgtctgatgtggggcgatctcctcgggcaggcgtttatggggctgtcgctgggctcg
gtcctgctgctggcggcgctggggctggcgatcacctatgggctgctgggtgtcatcaac
atggcgcacggcgagatgctgatgcttggggcgtacgccacgtggatggttcagcagatc
atggccagcgtcacgcctcagtggctggcgctgtatccggtcgtcgcgctgcctgtcgcc
ttctgcctgaccgcaggcatcgggatgatccttgaacgcacggtgatccgccatctctac
ggtcgtccgctggagacattactcgccacctggggtatcagcctgatgctgattcagctg
gtacgcatgacgtttggcgcacaaaacctggaggtggcaaacccggcctggctgtcaggc
ggggtgcaggtgtttgctaacctgacgctaccgtggaaccgcattgtggtattgggcttt
gtgctgatggtgctgttcttcacctggctggtcctgaataaaacccgtctcggcctgaac
gtgcgtgcggtaacgcaaaaccgcagcatggctgcctgttgcggggtgccgaccggacgt
gtcgatatgctggcgtttggtctgggctccggcattgccggtttaggcggcgtggcgctc
tcccagctgggcaacgtcgggccggaactgggccagggttacattatcgactccttcctg
gtggtggttcttggcggcgttggacaattggcagggagcgtggcggcagcgtttggcctt
gggatcttcaacaaaattcttgagccgcagatgggggccgtgctgggcaaaatcgtcatt
ctggtggccatcattctgtttattcagaaacgtccgcagggattgtttgcgctgaaaggg
agggtcactgactga

DBGET integrated database retrieval system