KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02017Help
Entry
ECL_02017         CDS       T01231                                 

Gene name
livK
Definition
(RefSeq) branched-chain amino acid transport system substrate-binding protein
  KO
K11959  urea transport system substrate-binding protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02010  ABC transporters
Module
enc_M00323  Urea transport system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECL_02017 (livK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_02017 (livK)
Transporters [BR:enc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Urea transporter [MD:M00323] [OT]
    ECL_02017 (livK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_5 Peripla_BP_6 ANF_receptor Pex14_N
Motif
Other DBs
NCBI-GeneID: 9124512
NCBI-ProteinID: YP_003612518
UniProt: A0A0H3CI73
Position
complement(2052535..2053806)
Genome map
AA seq 423 aa AA seqDB search
MHRRTLLKAFALSASVVAMGMSFGAQAADTIKVGIMHSLSGTMAISETPLKDVALMTIDE
INAKGGVLGKKLEPVVVDPASNWPLFAEKARQLLSQDKVAVVFGCWTSVSRKSVLPVFEE
LNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMSEDGGSAKRFFLLGTDYVYPR
TTNKILRAFLHSKGVEDKDIEEVYTPFGHSDYQTIVANIKKFSAGGKTAVVSTINGDSNV
PFYKELANQGLKATDVPVVAFSVGEEELRGIDTKPLVGNLAAWNYFESVDNPTNQAFVAD
YKAYAKAHKLPNADTVVTNDPMEATYVGIHMWAQAVEKAGTTDVDKVRAAMAGQSFKAPS
GFTLTMDATNHHLHKPVMIGEIEGNGQFNVVWQTEEPVRAQPWSPFIAGNDKKPDQPMKT
ASN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcgtacattattaaaagccttcgcgttgtctgcgtcagtcgttgctatgggg
atgagttttggcgcacaggcggccgataccatcaaagtggggattatgcattcgctctcc
ggcacgatggcgatctcagaaacgccgctgaaagatgtcgccctgatgacgattgacgag
atcaacgccaaaggcggggtgctgggtaaaaaactggagccagtggtggttgacccggcc
tctaactggccgctgtttgccgaaaaagcgcgtcagctgctgagccaggataaagtggcc
gtggtgtttggctgctggacctcggtgtctcgtaaatccgtactgccggtatttgaggag
ctgaacggtctgctgttctatccggtgcaatacgaaggcgaagagatgtcgccgaacgtc
ttctataccggtgcggcgccaaaccagcaggccattccggcggtggagtacctgatgagc
gaagacggcggtagcgctaaacgcttcttcctgttgggcacggattatgtctacccgcga
accaccaacaagatcctgcgcgccttcctgcactccaaaggcgtggaagacaaagatatc
gaagaggtctacaccccgttcggacacagtgactaccagaccatcgttgccaacatcaag
aaattctccgcaggcggtaaaaccgcggtggtctccaccatcaacggcgattctaacgtc
ccgttctacaaagaactggctaaccaggggctgaaagcaaccgatgtcccggtagtggcg
ttttccgttggcgaagaggagctgcgcgggattgacaccaaaccgctggtcggcaacctg
gccgcgtggaactacttcgagtccgttgataacccgaccaaccaggccttcgtggcggac
tataaagcctatgccaaagcccataagctgcctaacgccgataccgtagtcaccaacgac
ccgatggaagccacctatgttgggatccacatgtgggcacaggcggtagagaaagcaggc
accaccgacgtggataaagtgcgcgcggccatggccggacagtcctttaaggcaccctcc
ggctttacgctcaccatggatgccaccaaccatcacctgcataagccggtcatgatcggt
gaaatcgaaggtaacggccagtttaacgtggtctggcagacggaagagccggtacgcgcc
cagccgtggagcccgttcatcgccgggaacgataaaaagcccgatcagccgatgaagacc
gccagcaactaa

DBGET integrated database retrieval system