KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02019Help
Entry
ECL_02019         CDS       T01231                                 

Definition
(RefSeq) rhodanese domain-containing protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-GeneID: 9124514
NCBI-ProteinID: YP_003612520
UniProt: A0A0H3CJV8
Position
complement(2055267..2055680)
Genome map
AA seq 137 aa AA seqDB search
MSYVTEFPAAEPQEAVTHFLRRLSVETDCADVHHALTNNEQDFVLLHVVGKPEQFARRHV
PGAIHMPWSQITEARMAQWPADTLFVVYCAGPHCNGADRAALKLARLGLPVKIMIGGITG
WEDEQYAFASSETAAAL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgttactgaatttccggctgccgagccgcaggaagccgttacccattttctg
cgtcgcctgagcgtcgaaacagactgtgccgatgtgcaccatgcgctgacgaataacgag
caggactttgtgttgctgcatgttgtcgggaaacctgagcagtttgcccgtcgtcatgtg
cccggcgcgatacatatgccctggagccagatcactgaggcgcgcatggcgcagtggccg
gccgatacgctgtttgtggtgtactgcgccgggccgcactgtaacggcgcggacagagcc
gcactgaagctggcgcgtctcggactgccggtgaaaatcatgattggcggcatcaccggc
tgggaggacgaacagtacgcgtttgccagtagcgaaaccgctgccgcgttgtga

DBGET integrated database retrieval system