KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02020Help
Entry
ECL_02020         CDS       T01231                                 

Definition
(RefSeq) transcriptional activator FtrA
  KO
K13633  AraC family transcriptional regulator, transcriptional activator FtrA
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:enc03000]
    ECL_02020
Transcription factors [BR:enc03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    ECL_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 DJ-1_PfpI HTH_AraC TetR_N HTH_24 HTH_AsnC-type
Motif
Other DBs
NCBI-GeneID: 9124515
NCBI-ProteinID: YP_003612521
UniProt: A0A0H3CK94
Position
2055742..2056755
Genome map
AA seq 337 aa AA seqDB search
MRLLMPENSKKMTNLRQVSRPLVVVLAYDGLCTFEFGVAVEIFGLPRPELGDEWYRFAVA
GIDDGELRATGGIRILTDGGLDLLESADLIVVPGWRGMDAPVPAALSEALRRANARGCQL
LSICSGVFVLAASGLLNGRKATTHWRYIEALKARYPAIGVVEDVLYQDEGDILTSAGSAA
GIDLCLHVVRRDYGMETANSVARRLVIPPHRDGSQPQQLSRPVAQLRESQRLGQLFEFLH
NHLSVSHSVDSLARRVGMSQRTFLRRFQAATGTTPARWLLNERLLRAKDYLESSRLSIDS
IAEQTGFGQAATLRHHFRQQFALSPAQYRKQFARPPR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcttatgccagaaaacagcaaaaagatgacaaacttaagacaggtttcccgc
ccgctggtggtggtactggcctatgacggtttgtgtacctttgaatttggcgtggcggtg
gaaatcttcggtttgccacgtcccgagctgggcgacgaatggtatcgttttgcggtggcg
ggcattgatgacggtgagcttcgggcaaccggtgggatccgcatcctgaccgacgggggg
cttgatctgctggaatcggcagacctgatcgttgtgccgggctggcgagggatggatgcg
cctgttcccgcggcgctctccgaggccttacgccgggccaatgcgcgcggttgccagctg
ctttctatctgttccggggtgtttgttctggccgcgtcgggtctgctgaacgggcgtaaa
gccaccacccactggcgctatattgaggcgctgaaagcccgttatccggcgatcggcgtg
gtcgaggatgtgttgtatcaggatgaaggcgatattctgacctctgcgggaagcgcggca
ggcatcgatctctgtttgcacgtggtgcggcgggattacggtatggaaaccgccaacagc
gtcgcgcgccgtctggtgatccctccccaccgggatggctcccagccgcagcagttgagt
cgcccggtggcacagctgcgggagagccagcgtctggggcagttgttcgaattcctgcac
aatcacctgagcgtttctcacagcgtggattcgctggcgcgtcgcgtcggcatgagccag
cgcacctttctgcgccgctttcaggctgccacaggcaccacgcctgcgcgctggctgctt
aatgaacgactgttacgggcgaaagattatcttgagagcagccgtctcagcatcgacagc
attgctgaacaaaccggatttggtcaggcagcgaccctgcgtcaccatttccgccagcag
ttcgcgctttcccctgcccagtaccgtaaacagtttgcccgcccgccacgctga

DBGET integrated database retrieval system