KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02027Help
Entry
ECL_02027         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA EmrE TetR_C_30
Motif
Other DBs
NCBI-GeneID: 9124522
NCBI-ProteinID: YP_003612528
UniProt: A0A0H3CI81
Position
2062615..2063511
Genome map
AA seq 298 aa AA seqDB search
MNALLYGLVVVIWGTTWIAIFLQQGPVAAPVSIFWRFALASATMMVVLLALGRLCKLALR
DHLFCVLQGCCVFCFNFWCFYTAAAHINTGLESVIFSMAVLYNAINSFIFFGQRPPARFW
TAAALGLVGIITLFWDDLLASGWSVSLLTGIGLSALGTYGFSLGNMISMRHQRRGLETMT
TNAWAMLYGTLVMGCIALFRGDSFAPQWTMSYMGALVYLALFGSVIAFGAYFTLVGRIGP
GKAAYSTLLFPLVALSISTVYEGYVWHINGIIGLLLILGGNMVMFTRPETWFRRLRTA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattgttatacggactggtggtggttatctggggaaccacctggattgcaatt
ttcctgcagcagggtcctgtggcggccccggtgtccattttctggcgttttgcgctggcc
agcgccacgatgatggtggtgctcctggcgcttggccgcctgtgtaaactggcgctgcgg
gatcacttgttctgcgtgctgcaaggatgctgcgttttttgcttcaacttctggtgcttt
tacacggcagcggcgcatattaacactggcctggagtcggtgatattttccatggcggtg
ctctataacgccattaacagttttattttcttcggacagcgtccacccgcgcgtttctgg
acagccgccgccctgggtctggtggggatcatcaccctcttctgggacgatctgctggcc
agcggctggagcgtatcgctgctgactggcattggcctttccgcactcgggacctacggc
ttctcgctgggcaacatgatcagcatgcggcatcagcgcagagggctagagacgatgacc
accaacgcgtgggcgatgctctacggcacgctggtgatgggctgcatcgcgctgttcaga
ggcgacagcttcgcgccgcaatggacgatgagctacatgggggcgctggtctatctggcc
ctgtttggctcggtgattgcctttggcgcctacttcaccctggtcggacgcattggtccg
ggcaaagcggcctacagtacgctgctcttcccgctggtggcgctgtccatctccacggtg
tatgaaggctacgtctggcacattaacggcattatcgggttactgctgattctgggcggg
aatatggtgatgtttaccagaccggaaacttggttcagacgcctgcgtacggcataa

DBGET integrated database retrieval system