KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02030Help
Entry
ECL_02030         CDS       T01231                                 

Definition
(RefSeq) peptidase T
  KO
K01258  tripeptide aminopeptidase [EC:3.4.11.4]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:enc01002]
    ECL_02030
Enzymes [BR:enc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     ECL_02030
Peptidases [BR:enc01002]
 Metallo Peptidases
  Family M20
   ECL_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M42 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 9124525
NCBI-ProteinID: YP_003612531
UniProt: A0A0H3CKA2
Position
2066059..2067288
Genome map
AA seq 409 aa AA seqDB search
MGSPLSRQLTQRFFRYLAITSQSDAKVSTLPSTPGQHEMARELAKELTQLGLDDIVIDEF
ATVTAVKKGNVPGAPRIGFITHIDTVDVGLSPDIHPQILTFTGEDLCLNKEKEIWLRVNE
HPEILAYPGEEIIFSDGTSVLGADNKAAVTVVMTLLENLTSAHQHGDIVVAFVPDEEIGL
KGAKALDLKRFDVDFAWTIDCCELGEIVYENFNAAAAEIRFTGVTAHPMSAKGVLVNPLL
MATDFINHFDRQQTPECTEGCEGYIWFNGIQSGQNEAVLRANIRDFDQASFSARKQQIAD
VAALIAARHPTAKVEYQIEDTYSNISNAIGEDRRAIDLMFAAMESLGITPKPTPMRGGTD
GAALSAKGLLTPNFFTGAHNFHSRFEFLPLSSFEASYHTALQLCLLAAR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgccgctttccagacaattaacgcaacgctttttccgttatctcgccatcacc
agccagagcgatgcaaaagtcagcactctcccttccactccgggccagcatgagatggcg
cgggaactggcgaaagagctgacacagctgggcttagacgacattgtcatcgacgaattt
gccacggtcaccgcggtaaaaaaaggcaatgtgcccggcgcgccgcggattggatttatt
acccatattgataccgttgacgtgggattatcaccggatattcatccacaaatattaacc
ttcactggtgaagacctctgtctgaataaagagaaagagatctggcttcgcgtcaatgag
cacccggaaattctggcctatcccggcgaagagattattttcagcgatggaaccagcgta
ttaggcgcagataataaagccgccgtgactgtggtgatgaccctgctggaaaacctgacg
tcggcgcatcagcatggggatatcgtggttgcgtttgtgccggatgaggagattggcctg
aagggggcaaaagcgctggatctgaagcgcttcgacgttgattttgcctggacgattgac
tgctgcgagctgggtgaaattgtctatgaaaactttaacgcggcggcggcagaaatccgt
tttaccggcgtcaccgcgcaccccatgtctgccaaaggcgtgctggtgaacccgctgctg
atggcgacggattttattaaccattttgaccgccagcaaaccccggagtgcaccgagggg
tgtgagggctatatctggttcaacggcattcagtccgggcaaaacgaggccgtactgaga
gcgaatatccgcgacttcgatcaggcaagcttttccgcccgtaagcagcagattgccgac
gtcgcggcgctgattgccgcccgacaccccaccgctaaggtggagtaccagattgaggat
acctacagcaatatcagcaatgcgattggggaagatcgccgggccatagacctgatgttt
gcggcaatggaatcccttgggatcacccccaaacccaccccgatgcgcggcggaacagac
ggcgcggcgctttcagccaaagggttgttaaccccgaacttcttcaccggcgcgcacaat
ttccactcacggtttgagtttctgccgctgtcgtcgttcgaggcctcttaccacactgcc
ctgcagctctgtctgctggccgcccgttaa

DBGET integrated database retrieval system