KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02404Help
Entry
ECL_02404         CDS       T01231                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00071  Fatty acid degradation
enc00072  Synthesis and degradation of ketone bodies
enc00280  Valine, leucine and isoleucine degradation
enc00310  Lysine degradation
enc00362  Benzoate degradation
enc00380  Tryptophan metabolism
enc00620  Pyruvate metabolism
enc00630  Glyoxylate and dicarboxylate metabolism
enc00640  Propanoate metabolism
enc00650  Butanoate metabolism
enc00900  Terpenoid backbone biosynthesis
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01212  Fatty acid metabolism
enc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECL_02404
   00630 Glyoxylate and dicarboxylate metabolism
    ECL_02404
   00640 Propanoate metabolism
    ECL_02404
   00650 Butanoate metabolism
    ECL_02404
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECL_02404
   00072 Synthesis and degradation of ketone bodies
    ECL_02404
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECL_02404
   00310 Lysine degradation
    ECL_02404
   00380 Tryptophan metabolism
    ECL_02404
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECL_02404
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECL_02404
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECL_02404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enc04147]
    ECL_02404
Enzymes [BR:enc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECL_02404
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECL_02404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 9124890
NCBI-ProteinID: YP_003612896
UniProt: A0A0H3CL94
Position
2455115..2456296
Genome map
AA seq 393 aa AA seqDB search
MKNVMIVGATRTPIGSFRGSLSPLSAVELGAVAVRRLLEESSLSAGDTDELIFGQVLTAG
CGQNPARQTAIAAGLPVSTPATTVNLVCGAGLKAVQLAAQAIRCGDAEVVIAGGQESMSN
APYLLDGARSGLRFGHTGLQDSMIVDGLWDAFNDYHMGITAENVARQYGISREQQDAFAA
GSQQKAASAIESARFEAEITPVTVKQGKKPPLVIRHDEQPRPGTTAEQLAQLRPAFRQED
GTVTAGNASTLNDGAAAVLLMSEEKARASGLPVLGRIVSYAVTGVDPSVMGIGPVSACQT
ALARAGWTLDEVDLIEANEAFAAQALAVGNLLGWDARKVNVNGGAIALGHPIGASGCRIL
VTLLHEMQRRDAKKGLVTLCIGGGQGIALTVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtcatgatagtcggggcaacgcgaacgccgattggcagttttcgcggttcg
ctctctcccctttccgccgttgaacttggtgctgtcgcggtgcgccgcctgcttgaggag
agctcgctttcggcaggtgacacagacgaactgatttttgggcaggtgctgacggcaggc
tgcggacaaaacccggcacgtcagacggctatcgccgccggactgcccgtcagtacccct
gccaccacggtcaatctggtctgcggcgcggggctgaaggcggtacagcttgcggcacag
gctatccgctgtggagacgcagaggtggtgatcgcgggcggtcaggagagcatgagcaat
gccccttacctactggatggcgcccgttccgggctgcgttttggccacacaggcctgcag
gacagcatgatcgtcgacggcctgtgggatgcgtttaacgattaccacatggggatcact
gcggaaaacgtcgcccggcagtacggcatttcacgcgaacagcaggatgccttcgccgcc
gggtcacagcaaaaggcggcgtctgccatcgaatctgctcgctttgaggccgagattacc
cctgtaacggtgaaacagggcaagaagccgccattggtgattcgtcatgacgaacaaccc
cggccaggaaccaccgcagaacagcttgcgcaactacgccccgcgtttcgccaggaggac
ggcacggtcacggcggggaatgcctccaccctgaacgatggcgccgccgcggtgttgctg
atgagcgaagaaaaagcgcgggcgagcggactaccggtgctgggccggatcgtgagctac
gccgttaccggggttgacccgtccgtaatgggcatcggccccgtcagcgcctgccagacc
gcgctggcgcgggcaggctggacgctggatgaggtggatctcatcgaagccaacgaagct
tttgccgcgcaggcgctggcggttggtaacctgcttggctgggatgcgcgcaaggtgaac
gttaacggtggcgctatcgcgctgggccatccgattggtgcatccggctgtcggatcctt
gtgacgctgctgcatgagatgcagcgccgtgacgccaaaaaagggctggtcactctgtgc
ataggcggcgggcaaggcattgcgctgaccgtcgagcgttaa

DBGET integrated database retrieval system