KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03433Help
Entry
ECL_03433         CDS       T01231                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00450  Selenocompound metabolism
enc00970  Aminoacyl-tRNA biosynthesis
enc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECL_03433
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECL_03433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:enc01007]
    ECL_03433
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:enc03016]
    ECL_03433
Enzymes [BR:enc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ECL_03433
Amino acid related enzymes [BR:enc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ECL_03433
Transfer RNA biogenesis [BR:enc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ECL_03433
 Prokaryotic type
   Other AARSs
    ECL_03433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 9125910
NCBI-ProteinID: YP_003613916
UniProt: A0A0H3CR05
Position
3511244..3513277
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGVSPEQMIAEMSQEHQTDFAGFDISYDNYHSTHSEENRELSTLIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIDPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTVSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
AAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFIAKRFDGVLSAELADPELYK
TFTDAAAAVGEAWESREFGKAIREIMALADVANRYVDEQAPWVVAKQEGRDADLQAICTM
GLNMFRVLMTWLKPVLPQLAARAEAFLNTELSWDAIQQPLLGHKVNTFKALYNRIEMKQV
EALVEASKEEVKAAAAPVTGPLADDPIQETITFDDFAKVDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQLLIGRQTVMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDEGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaaaaaaattctggtaacgtgcgcactgccgtacgccaacggctca
atccacctcggccacatgctggagcatatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggttaacttcatctgcgcggacgatgcccacggcacgccgatcatg
ctgaaagcccagcagctgggtgtttccccggagcagatgattgccgaaatgagtcaggag
catcagaccgattttgctggctttgacatcagctatgacaactaccactccacgcacagc
gaggagaaccgcgagctgtcaacgcttatctacacccgtctgaaagagaacggttttatt
aaaaaccgcactatctctcagctgtacgatccggaaaaaggcatgttcctgccggaccgt
ttcgtcaaaggcacctgcccgaaatgtaaatcaccggatcagtacggcgataactgcgaa
gtgtgcggcgctacctatagcccgacagagctgatcgacccgaaatcggtggtctccggc
gccacgcctgtgatgcgtgactccgagcacttcttcttcgacctgccatcctttagcgaa
atgctgcaggcgtggacccgcagcggcgcgctgcaggagcaggtagcgaacaaaatgcag
gagtggttcgaatccggcctgcagcagtgggatatctcccgcgatgcgccctactttggt
ttcgaaattccaaatgcaccgggcaaatatttctacgtctggctggacgcgccaatcggc
tacatgggctccttcaagaacctgtgcgacaagcgtggcgacaccgtcagcttcgacgaa
tactggaagaaagattccaccgccgagctgtatcacttcatcggcaaagacatcgtttac
ttccacagcctgttctggccggcaatgctggaaggcagcaacttccgcaagccaaccaac
ctgtttgttcacggctacgtgacggtgaacggcgcgaagatgtccaaatcgcgtgggacg
ttcatcaaagccagcacctggctgaaccactttgatgcagacagcctgcgttattattac
gcggcgaagctctcttcccgcatcgacgatatcgacctgaacctggaagatttcgtgcag
cgcgtgaacgcggacatcgtgaacaaggtggtgaacctggcgtcccgaaacgcgggcttt
atcgccaagcgttttgacggcgtgctttctgccgagctggccgatcctgagctgtataaa
accttcaccgatgccgccgctgcggttggcgaagcctgggaaagccgtgaattcggtaaa
gcaattcgtgaaatcatggcgctggccgatgttgccaaccgctatgtggacgagcaggcc
ccgtgggttgtcgcgaaacaggaaggccgtgacgctgacctgcaggcgatctgcaccatg
ggtctgaacatgttccgcgtgctgatgacctggctgaagcctgtactgccgcagctggca
gcgcgtgcagaagcgttcctgaacaccgaactgagctgggatgcaatccagcaaccgctg
cttggccacaaggtgaataccttcaaggcgctctacaatcgcatcgaaatgaaacaggtt
gaagccctggtggaagcctcgaaagaagaggtgaaagcagctgccgcaccggtgaccggc
ccgctggcagacgatccgattcaggagaccatcacctttgacgatttcgctaaagttgac
ctgcgcgtggcgctgattgaaaacgcggaattcgtggaaggctctgacaagctgctgcgc
ctgacgctggatctgggcggtgagaagcgtaacgtcttctccggcatccgttctgcctat
cctgatccgcagttactgattggccgtcagaccgtcatggtcgcgaacctggcaccgcgt
aaaatgcgcttcggcatctctgaggggatggtgatggccgcaggccctggcgggaaagat
atcttcctgttaagccctgacgaaggcgcgaagccgggtcagcaggtgaaataa

DBGET integrated database retrieval system