KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03655Help
Entry
ECL_03655         CDS       T01231                                 

Definition
(RefSeq) histidine/lysine/arginine/ornithine transport system ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECL_03655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_03655
Enzymes [BR:enc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ECL_03655
Transporters [BR:enc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    ECL_03655
   Histidine transporter
    ECL_03655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_13 AAA_29 AAA_16 ABC_ATPase AAA_33 PRK AAA_23 G-alpha ATPase_2 NACHT AAA_24 RsgA_GTPase DUF87
Motif
Other DBs
NCBI-GeneID: 9126132
NCBI-ProteinID: YP_003614138
UniProt: A0A0H3CNN8
Position
complement(3732617..3733396)
Genome map
AA seq 259 aa AA seqDB search
MMMAENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPS
EGSIVVSGQNINLTRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPV
QVLGLSKQEARERAVKYLAKVGIDERQQIKYPVHLSGGQQQRVSIARALAMEPEVLLFDE
PTSALDPELVGEVLRIMQKLAEEGKTMVVVTHEMGFARNVSNHVIFLHQGKIEEQGHPDE
VLANPQSPRLQQFLKGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggctgagaacaaattaaacgtaattgatttgcacaaacgctacggcgaacat
gaagtgctgaaaggggtgtcgctgcaggcaaatgcaggcgacgtgatcagtattatcgga
tcatctggctcggggaaaagtaccttcctgcgctgcatcaacttcctcgaaaagccgagt
gaaggctcaattgtggtgagcgggcagaatatcaatctgacccgggataaagacggccag
ctgaaggtggctgataagaaccaactgcgcctgctgcgcacgcgactgacaatggttttc
cagcacttcaacctctggagccacatgacggtgctggagaacgtgatggaagcaccggtt
caggtgctgggtttaagcaagcaggaggcccgtgagcgcgcggtgaaatacctggcgaaa
gtgggtatcgatgagcgacagcagataaagtacccggtgcatctctctggtggtcagcag
cagcgtgtctctatcgcccgtgcgctggcgatggagcctgaagtattgctgttcgacgaa
ccgacctcagcacttgacccggaactggttggcgaagtgctgcgcatcatgcaaaagctt
gcggaagagggtaaaaccatggttgtggtaacgcacgagatgggctttgcccgcaacgtc
tcgaaccacgtgatcttcctgcatcaggggaaaatcgaagagcagggacatccggatgag
gtgctggcgaatccgcaaagcccgcgtttgcagcagttcctgaagggctctttgaagtag

DBGET integrated database retrieval system