KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04091Help
Entry
ECL_04091         CDS       T01231                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Enzymes [BR:enc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ECL_04091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_32 CMAS GCD14 NodS DREV
Motif
Other DBs
NCBI-GeneID: 9126568
NCBI-ProteinID: YP_003614574
UniProt: A0A0H3CQT2
Position
complement(4193476..4194102)
Genome map
AA seq 208 aa AA seqDB search
MVSKRVQTLLEQLRAQGIRDEHVLDALAQVPREKFVDEAFEHKAWENVALPIGQGQTISQ
PYMVARMTELLELTPDSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPAALLSQLDEGGILVLPVGDEQQLLK
RVRRRGDEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaaacgtgtacaaactcttctggaacaacttcgcgcacaggggatccgcgac
gagcatgtgcttgacgcgctcgcccaggttccgcgtgagaaatttgtagatgaggcgttt
gaacacaaagcgtgggaaaacgtggccttgcccatcgggcagggccagacgatttcgcag
ccctacatggtggcgcgcatgacggagctgctggagctcacccccgactcccgcgtgctg
gagattggcaccgggtccgggtatcagactgcgattctggcgcatctggtgcatcatgtg
tgctcggttgagcggatcaaaggtttacagtggcaggcgcgtcgtcgcctgaaacaactt
gatttacacaatgtttcgacacgacacggtgatggatggcagggttggcaggctcgcgcc
ccgtttgacgctatcatcgtgacggcggctccaccggagatccctgcggccctgttgtcg
cagctggatgaggggggcattcttgtattgcctgttggcgatgagcagcagctgttaaag
cgcgttcgtcgacgtggcgacgagtttattatcgataccgtagaagccgtgcgctttgtg
cctctggtaaagggggaactggcctaa

DBGET integrated database retrieval system