KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04240Help
Entry
ECL_04240         CDS       T01231                                 

Definition
(RefSeq) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00030  Pentose phosphate pathway
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01230  Biosynthesis of amino acids
Module
enc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
enc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECL_04240
Enzymes [BR:enc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ECL_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-GeneID: 9126716
NCBI-ProteinID: YP_003614722
UniProt: A0A0H3CPB1
Position
complement(4351130..4351789)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNEVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARELVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcagtaggatgggccgcgctccagtacgtgcaaccg
ggtactatcgtcggtgtgggtacggggtcgacggcggcacactttatcgatgcgctgggc
acgatgaaggggcagatcgagggcgcggtttcgagctccgatgcttccacggaaaagctg
aaaagcctcggcattaccgttttcgatctgaacgaagtggaccgtctggggatctacgtt
gatggcgcggatgaaatcaacgggcatatgcagatgatcaaaggcggcggcgcagcgctg
acgcgtgaaaagatcatcgcctccgtggccgataaattcatctgtatcgcggatgcatcc
aagcaggttgatattctgggtaaattcccgttgccggttgaagtgatcccaatggcgcgc
agcgccgtggcacgtgagctggtaaaactgggcggacgtcctgaataccgtcagggtgtg
gtcaccgataacggcaacgtgatcctcgacgttcatggcctggaaattctcgacgcgatc
gcgctcgaaaacgccatcaacggcattccgggcgtggtaacagtagggttattcgccaac
cgtggcgcggatgttgcgctgatcggcacggctgatggcgtgaaaaccatcgtaaaatga

DBGET integrated database retrieval system