KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04988Help
Entry
ECL_04988         CDS       T01231                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00860  Porphyrin and chlorophyll metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
Module
enc_M00121  Heme biosynthesis, glutamate => heme
enc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECL_04988
Enzymes [BR:enc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECL_04988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 9127453
NCBI-ProteinID: YP_003615459
UniProt: A0A0H3CV36
Position
5111025..5111720
Genome map
AA seq 231 aa AA seqDB search
MSRLRALGQVAWSFPLIEFSPGRELSALADHMNTLQEGDLLFALSQHAVEFAHAQLQQQG
LNWPTAPRYFAIGRSTALALHTVSGADVRYPLDRETSEVLLQLPELQTLIGKRALILRGN
GGRELLGETLRERGADVTFCECYQRCAKHYDGAQEAMRWHTRGITTLVVTSGEMLQQLWS
LVPLWYRENWLLHCRLLVVSERLANLARELGWQDIRIADNADNDALLRALQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtctgcgcgcactggggcaggtggcctggagttttccgcttattgaattctcc
ccgggtcgggagctgtccgcgctcgccgaccatatgaatacccttcaggaaggcgacctg
ctgtttgccttgtcgcaacatgccgtggaatttgcccatgcgcagctacaacagcaggga
ctgaactggcctaccgcgccacgctatttcgcgattggccgttccaccgccctggcgctg
cataccgtaagtggagcagacgtacgttacccgttagatcgggaaaccagcgaagtcttg
ctacaattacctgaattacaaaccctaatcggaaaacgtgcgctgattttacgcggtaac
ggcggacgcgaactgttaggcgaaacgctgcgtgaacgcggagctgacgtcacgttttgc
gaatgttatcaacgctgtgcaaaacattacgatggtgcacaagaggcgatgcgctggcat
acgcgcggcattacaacgctggtggtgaccagcggcgaaatgctgcagcaactctggtcg
ctggtgccgctttggtatcgtgaaaactggttactccactgtcggcttttggtcgtcagt
gagcgtctggcgaacctcgcccgggaactgggctggcaagatattcggatcgctgataac
gccgacaacgatgcgctgctgcgcgcattacaataa

DBGET integrated database retrieval system