KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05057Help
Entry
ECL_05057         CDS       T01231                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00010  Glycolysis / Gluconeogenesis
enc00051  Fructose and mannose metabolism
enc00562  Inositol phosphate metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01230  Biosynthesis of amino acids
Module
enc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
enc_M00002  Glycolysis, core module involving three-carbon compounds
enc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_05057
   00051 Fructose and mannose metabolism
    ECL_05057
   00562 Inositol phosphate metabolism
    ECL_05057
Enzymes [BR:enc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECL_05057
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECL_05057
  Exosomal proteins of bladder cancer cells
   ECL_05057
  Exosomal proteins of melanoma cells
   ECL_05057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-GeneID: 9127522
NCBI-ProteinID: YP_003615528
UniProt: A0A0H3CTK6
Position
5195774..5196541
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVTGCAVAIAPPDMYLDLAKRAADGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNASNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaaagagctggctggcgtgactggctgcgcggttgctatc
gctccgccggatatgtacctggatctggctaaacgtgccgctgacggcagccacatcatt
ctgggcgcacagaacgttgacgttaacctgtctggcgcattcaccggtgaaacctccgct
gaaatgctgaaagatatcggcgccaaatacatcatcatcggccactctgagcgtcgcacc
taccacaaagaatccgacgagttcatcgcgaagaaatttgcggtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaacggaa
gaagtgtgcgcacgtcagatcgacgctgtgctgaagacgcagggcgcggcagcattcgaa
ggcgcggttatcgcttacgagccagtctgggcgatcggtaccggcaaatctgcaacccca
gcgcaggctcaggcggttcacaaattcatccgtgaccacattgctaaagccgacgcgaaa
gtggcagagcaggtcatcatccagtacggcggttccgtaaatgcctctaacgcggcagaa
ctgttcacccagccagacatcgatggcgcgctggttggcggtgcatccctgaaagctgac
gctttcgcggtaatcgttaaagcggcagaagcggctaagcaggcgtaa

DBGET integrated database retrieval system