KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B066
Entry
ECL_B066          CDS       T01231                                 

Definition
(RefSeq) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enc02044]
    ECL_B066
Secretion system [BR:enc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECL_B066
SSDB
Motif
Pfam: TrbI CRCB Suppressor_APC
Other DBs
NCBI-GeneID: 9111648
NCBI-ProteinID: YP_003602836
UniProt: A0A0H3CV28
Position
pECL_B:32463..33710
AA seq 415 aa
MVDNKFPLIEKARAWFHRQPSAQQKNIKKYGTIGTFVIIALGIYYLTGQDKKKPVEPPKQ
TDVAEAKTSSYVQDDIVSTLGGQIKDLKSGIDNQVKDAVADAMAKGQFSLTPPPAAVDTN
TPAGSSQTAQSENAQSPASGNAADGTGMLSYPTPPAYTDPSSQGGKQDSGNGEEPSVVWV
GGISDGNGDIGMAAPQEDNSAKKNEIQLPVGFMKAKLLVGVNALTGQYGSDNPQTVMFRV
QAPAQLPNFIKMNLRGCFVIANASGNLSAERIIVLPVSMHCMTMDGGYIVEGDVTGFVSD
RDGKRDMSARVVSRAGRLMAATVFAKSIEGFANVIGNQSIQQNVSPLGSINTIKPDEASK
NAAATGVAGGFTEVSKYLLNLVQQTSPALETGPGKDVTLFVQKTATLEIKQVRIK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggttgataataaattcccgcttatcgaaaaagcgcgagcctggttccatcgccagcct
tctgctcagcagaagaatattaaaaagtacggcactattggtactttcgttatcattgcc
ctgggtatttattacctgacgggtcaggataaaaagaaacccgtcgaacctcctaaacag
actgatgttgctgaggctaaaaccagctcttacgtccaggacgatattgtttccactctc
ggtggtcagatcaaagatctcaaatcaggcattgataatcaggttaaagacgcagtggct
gatgctatggcaaaaggccagtttagtctcacccctcctcctgctgctgttgatacaaac
actccagcgggaagttcgcaaactgctcagagcgaaaatgctcaatcaccggcttccggt
aatgcagccgacggtactggcatgctgagctatcccacacctcctgcttacactgatcca
tcctctcaggggggtaaacaggattcaggaaatggagaggaaccttctgttgtatgggtc
ggcggtatatctgacggtaacggcgatattggtatggcagctccccaggaggataactcc
gcaaaaaagaacgagatccagttgccggttggatttatgaaagcaaagctcctggttggc
gttaacgcccttacaggtcagtatggctctgataatccccagacagtgatgttcagggtt
caggctccggcacagttacctaacttcatcaaaatgaacctgcgcgggtgcttcgtgata
gccaatgcctccggcaatctcagcgctgaacgcatcattgtgcttcctgtttctatgcac
tgtatgacaatggatggcggttacatcgttgaaggtgatgttaccggatttgtttctgat
cgtgacggtaaacgtgatatgtcagcgcgagtggtatcccgtgccggtcgtctgatggcc
gcgactgtttttgctaaatccattgagggctttgcgaacgttattggcaatcaaagcatt
cagcagaacgtttcccctctgggtagcatcaataccatcaagccagacgaagcctctaaa
aatgcagctgcgaccggcgtggccggaggttttactgaggtatcaaaatacctgttaaac
ctcgttcagcaaacctctccagctcttgaaaccggccctggtaaagacgtgactctcttt
gttcagaaaaccgcgacactcgaaatcaaacaagtaaggatcaaataa

DBGET integrated database retrieval system