KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B069
Entry
ECL_B069          CDS       T01231                                 
Name
(GenBank) type IV conjugative transfer system protein TraN
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Other DBs
NCBI-ProteinID: ADF65031
UniProt: A0A0H3CT14
Position
pECL_B:36769..38799
AA seq 676 aa
MKNVNILALGAFMLPVSFAHAQIQATPDTAKITASKDIAGSISSTVKGKTSNASRLNESQ
IRPVSGENNMRTYDGQTAFNGKAVCKGSSEFMRMLVQPTTNGNLKLLNIMQDTDMNGSLD
ITTSPGWDISVVCSNGFQTCSDANNAATCTSWAWVADPKSYQLGRKNVAMTELGGCYCIN
NSCGSNLAWNNLGQILNDLGGGASQALSRANPWFTLSQIKVDGVSASFVGGDTASCSIGD
SEGFFGTADGKKILNYKDNYNAMKTDANSQKTTSDAYRMITEGSLNPNETSDVYSCDITR
NVNLDEPKLNEIIAFDGGQGSVQQCGTDCLQLVLGRLGDNYWSGTCKYFEVDSNFFIKDH
TRIASATLINAVFDDWMQLWAGDKVVWSGPYGNWNDAGPVPGACELSKSWNQSPNTDFKK
YLDKNGPVKFKIRVEVSGEGEGYALVRLKADLSCREGDEYVSNTCTAYEQDQNCQLVDET
VDGVKTFTGSINTGLIPLPQTQVLQGSFCSVAVKRDWFKKKRQYRCNRKTDFNFDKIIER
KAYIDKTVTPGDYKDKMFNNGKVTYGAGELFWPDMPKVGDCINMCKTRKPKQTPDMAVSG
QVDKNNKASVIKYDNFYYECDATNKCPAEPGEEVIKACQCLNEFAEASAIMQVIRQAGQD
MICSSGNPKKPDGSSK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgaagaatgtgaatatcctggctttgggagcatttatgctccctgtttcatttgcgcat
gcgcaaattcaggccaccccggacacagccaaaattactgcaagtaaggatatcgcaggt
tctatttcatcaacggtaaaagggaaaaccagtaacgcctcccgtttaaatgaatcgcag
atccgtccggtatccggtgaaaacaatatgcgaacctatgacggccaaaccgcatttaac
ggcaaagccgtttgtaaaggctcatctgagttcatgcgcatgcttgttcagcccacaacg
aacggtaatttaaaactgctgaatatcatgcaggataccgatatgaacggctccctggac
atcacaacgtcaccaggttgggatatttcagtagtttgcagtaacggctttcagacgtgt
tccgatgcgaataatgctgctacctgcacttcttgggcctgggttgcagatcccaagagc
taccaactaggccgtaaaaatgtcgctatgacggaactgggtggttgttactgcataaat
aacagctgtggcagcaatctcgcctggaataatctgggccaaattcttaacgatctgggt
ggcggcgcatcacaggcactttcgcgggcaaacccctggttcacactgagtcagattaag
gttgacggcgtatcggcatctttcgttggcggtgacacagcttcatgttcgattggtgat
tcagaaggtttctttggtactgctgatggtaaaaaaatccttaattacaaggataattat
aacgccatgaagacggatgccaacagtcagaagaccaccagtgatgcctaccgcatgatc
actgaaggcagcctgaacccaaacgaaacgtctgatgtgtactcatgcgatatcactcgc
aacgtgaatctggatgaacctaagctgaatgaaattatcgcctttgatggagggcaaggt
tccgttcagcaatgtggcactgactgcctgcaactggttttaggtcgtctgggtgataac
tactggagcggtacgtgtaaatactttgaagttgattctaactttttcatcaaagaccac
acccgtatagccagcgctacgctcattaacgccgtttttgatgactggatgcaactgtgg
gccggagataaagtcgtctggtcaggaccgtatggcaactggaacgatgcaggcccggtg
cctggcgcatgcgaactgagcaagtcatggaaccaatctccgaatacggactttaaaaag
taccttgataaaaatggcccggtcaaattcaaaatccgcgtcgaagtctctggtgaaggc
gaaggatatgctctggtacggctgaaggctgacctctcctgtcgtgaaggtgatgagtat
gtctcaaacacctgtactgcttatgaacaggaccaaaactgtcagcttgtcgatgaaact
gtggacggagtgaaaactttcactggtagcatcaacaccggccttatccctcttccccaa
acccaggttcttcagggcagcttctgctctgtcgctgtgaaacgtgattggtttaaaaag
aaacggcaataccgatgcaaccgcaagacagacttcaatttcgacaaaataattgagcgt
aaggcctacatcgataaaaccgtcacgcccggcgactataaagacaaaatgttcaataac
ggcaaggtaacttacggtgcaggtgaattattctggcctgacatgccgaaagtgggtgat
tgtataaatatgtgcaaaacccgtaagccgaaacaaactccagacatggctgtttccggg
caggttgataaaaataataaagcgagcgtgatcaaatatgacaatttctattatgagtgt
gatgcaacgaacaaatgccctgctgaacctggcgaggaagttattaaagcttgccagtgt
cttaatgagttcgcagaagcttcagcgatcatgcaggttattcgccaggctggtcaggac
atgatctgtagttccggcaatcccaagaagccagatggttcaagcaaataa

DBGET integrated database retrieval system