KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B073
Entry
ECL_B073          CDS       T01231                                 
Name
(GenBank) sex pilus assembly and mating pair formation protein TrbC
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TrbC_Ftype Glyco_hydro_46
Other DBs
NCBI-ProteinID: ADF65035
UniProt: A0A0H3CWQ8
Position
pECL_B:42892..43641
AA seq 249 aa
MKNSTIFLLASLATFGVCATGSEPLSVKISPEMMAAARNANAQAVQTLNDDEQGVARQFA
SSIAEFSKSDAFKKKQEAVKSQVFASAGMQDDEKKEDGPKLAGNQLVMFVSSSMPLVTLR
KYAHDLSKVGGVMVMRGTVGGISKMVDTITLTRNVLNADPSCEGAKCKMWGTEMLIDPML
FRIYGINKVPALIYQPDMQIQSYCDGLEKVNKASAVVYGDASVRALLERMNMISPDEKVK
RLITTLEKA
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagaacagcaccatttttctcctggcctcccttgcaacgttcggtgtctgtgcaacc
ggtagtgaacccctgtcagtaaaaatatcaccagaaatgatggccgcagcccggaatgcg
aatgcacaggctgtgcagacactcaatgatgatgaacagggagtggcgcgtcagtttgcg
tcgtcaattgccgaattttcaaagagtgatgccttcaagaaaaagcaggaggcggtgaag
tcgcaggtttttgcctctgctggtatgcaggatgatgagaagaaagaagacgggccaaaa
ctcgccggtaatcagctcgtcatgtttgtttccagcagtatgccgcttgtcactctgcgt
aaatatgcacacgacctctccaaagtaggaggagtgatggtcatgcgaggtacagtaggc
gggatcagtaaaatggtcgataccattacgctgacccgtaatgtacttaacgcagatccc
tcctgcgaaggggcaaaatgcaagatgtggggtacggaaatgctcatcgaccccatgctg
ttccgcatttacggcatcaataaagtaccagctcttatctaccagcctgacatgcagatt
cagagttactgcgatggcctggaaaaggtcaataaggcatcagctgtcgtgtatggtgat
gcgtccgttcgcgcactgctggagcgaatgaacatgatttcgccggatgaaaaggttaag
cgcctgatcacaacactggagaaagcatga

DBGET integrated database retrieval system