KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B116
Entry
ECL_B116          CDS       T01231                                 
Name
(GenBank) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TrwC AAA_30 TraI_2B AAA_19 Viral_helicase1 Mucin_bdg UvrD_C_2 SH3_13 Myosin_N cobW
Other DBs
NCBI-ProteinID: ADF65078
UniProt: A0A0H3CV82
Position
pECL_B:complement(74139..79145)
AA seq 1668 aa
MLSVAKVTNVAQASSYYNSPDQYYDKDSGDITSRWGGAGAEILGLEGPVESEDFVRMLEG
RISPEIHLGKNGGDGTISHVPAWDFTLSAPKSVSVLALAGNDKRLVDAHIKATAETMKFL
EKEYALTRISNGGNTEYTKVNNLVYASYVHTESRKHDPQLHSHNVVMNAVMDESGQWRSL
ETLKMFENQLGIGLVYRSHLAKLVKQLGYDLEIDHETGLWDIKGVPHSLLDAFSKRRKEV
LEAAKQYGLFDAKSMEKAALYSRESKTHMEYDELKASWEETVKESGVSLDEVINRSYDNA
KTFKRLDDPQPSFDSENSSEAVTGVSGPKENSHSVAPEHLVGNETDFSTPSNDTNMNHIE
RGEGVEVSPGNPLTNAGLLSGIANINGTERATEKYAREYISHQDLSASELAAILHDVRLA
YKVKAADEAVFTHSSVMSEAMGLAIGEALPGDIEQILRAMVNSGELLPRTSRSGNGEAAY
TTPKAFEKEREMVLTMLSGKESRQAAGDVSSIAAYIDQFEAEKTVEFGSQFAFSPDQRQA
IIDAATNKDLVSGIQGFAGTGKTTLLQCLIGYGQSKGFSFKGLAPTGSATETLAKETGIP
ASTVDSFLYRRMKGTVSTREIWLVDEASLVGADNQHALIMEAERSNAKLLLLGDKKQMES
VDWGRPFAVLQGFGMQTSNVQTIIRQKDEQLRAAVYDSISGNFSQAFSRLKDSVYDMEKH
SILDDYLALSQADREKTLVIIPDNEGRQDFNASVHEKRVNDGELSANEVAVRSLLSENLN
EAERTDSRYYRFGQIIEFQLDHGEFKKGEFWKVAEVSGKELLLKSGDGQERKFNPSEITG
KSKFAIDVFREDKILFSEQEKVVFTKSRKDLNVRNGDEFKVSRIDSTSGTFILTDEKGKE
LSLDSSKLHNISHSYAMTSYKAQGKTVDRVMAQIESWRRNLVNERSFYVNLSRARYEARL
YVDNVGKVIKALSEHDANKTTSLTGFSTKSMKRAAEHLQAESTDTRQLYADLNIATQKLA
NKQGVFSHSALVAETLKNTLGTYDVRDIETAIYAMRMRGEVGLSHINHEKVNSENYYTMP
QNIRNEAQIVRHMLQGKDRYAPIAGKSVVSRYLSAREDKARQGIAEPVSAATQAALTTVM
TSRDEAILITGSDLSGHRDVMREIGKDIAKERGYRVKGFSTTAEGVKQMRESMKFSANIY
QHLDQMEAKIAAGQIVRPGKELWVVENVSQMGAENVLRLQQAARYVGARMVLVADRQENS
IAWGNMPSLLAEQGIATIDFDKANRSLNPEINLATDKLTQGKIEDALAHVSPMMSEVRDL
DNQNNDRTIRLNVIANSWLNLSPEDRAKTAIVIPDYLSRNKVDVQIRRGLQSEGVLQGTP
LTTALYRNANLDPFEKKVATNYKPGQVVQFESQRPGIEKGAYYTVEAVNKAGNELILVSL
EAGHRVTINAADIAGSRNNSVQVFHVEQKQIQKGETLRFTRTVPADKLESADGKGVSSKM
TGSVVSLDGTKVTLRLANNRQVTVDAASWKHMEWGYSNNMFNIKDKQFDNVITLMESWKK
QFATQEALHNALTKTAVNLRIITDDKEKLLDSLRTNPGFRQTALQDRKVSITKSDMAAFD
KQFGTGLGFGMRSLMKLEAAVDKAVTSTVSKVVEKTREVAQKTRQKSL
NT seq 5007 nt   +upstreamnt  +downstreamnt
atgcttagtgttgctaaagttacaaatgttgctcaggcttcttcgtattataattcgcct
gaccaatattatgataaggatagcggtgatattacgtctcgatggggcggtgctggcgct
gaaattttaggtctggaggggccagtcgaatctgaagattttgttcggatgcttgagggg
cgtataagtcccgaaattcatttgggtaaaaatggcggtgatggaacaatttcacatgtt
cctgcctgggattttactttatcagccccaaaaagtgtttcggtgttagcattggctggt
aacgataaacgcttagttgatgcgcacataaaagctacagctgaaacaatgaagttttta
gagaaagaatatgcattaacgcgtatatcaaatggcggtaatactgaatacaccaaagtt
aataatctggtatatgcaagctacgtccatactgaatcgagaaaacatgatccgcagtta
cactcgcataatgtcgtgatgaatgcagtgatggatgaatcagggcaatggcgaagcctt
gaaaccctaaaaatgtttgaaaatcagcttggaattggtctggtttatcgttctcattta
gccaaattagtaaagcaattaggctacgatctcgaaattgatcatgaaactggcctttgg
gatataaaaggcgttcctcattctcttttagatgcgttctctaaacgtcgcaaagaagtt
cttgaggcggctaagcagtatggactgtttgatgctaagtctatggagaaagcggcgttg
tatagtcgcgagtccaaaacgcacatggaatatgacgagctgaaagcctcatgggaagaa
acagttaaagaaagtggggtatcacttgatgaggttattaaccgctcctatgacaatgct
aagacgtttaaaaggttagatgaccctcaaccttcttttgacagcgaaaactcttctgaa
gcggttacaggcgtttctgggcctaaagaaaatagtcactcagtagcgccggagcatctg
gttggaaatgaaactgatttttctacaccctccaatgatacaaatatgaatcatattgag
cgtggcgaaggagtagaggtaagtcccggcaaccccttgacgaatgcaggcctactttct
ggtattgcgaacattaacggcactgagcgagctacagagaagtatgcacgagagtacatc
agccatcaggacctttccgcgagcgagctggcggcgattctccatgacgtcaggcttgcc
tataaagttaaggcggcagacgaagcagtgtttacgcacagcagcgtaatgagtgaggca
atgggtcttgcaataggcgaggctctacctggtgatatagaacaaatactccgggcgatg
gtcaactccggggagctgcttccccgtacttccagatcaggaaatggtgaagctgcttac
accacgccgaaagcattcgaaaaagagcgtgaaatggtcctgaccatgcttagtggtaag
gagtcgcgtcaggccgccggtgatgtttccagtatcgctgcatacatcgatcagtttgaa
gcagaaaagaccgtagaatttggttcacagtttgctttctcgccagaccagaggcaggcg
attatcgatgcggccacaaacaaagacctggtatccggcatacagggattcgccggaacc
ggtaaaactacgttactccagtgtctgattggttacggtcaatctaaaggctttagcttc
aagggattagcgccaaccggttccgctacagagacgctcgcgaaggaaacaggtatcccg
gccagcacggtagattcattcctgtaccggcgcatgaaaggcactgtcagcacccgtgaa
atctggcttgtcgatgaggcgagtcttgttggggctgacaatcagcatgccctcataatg
gaagctgagcgaagcaatgcaaaattgttgcttcttggcgataagaaacagatggaatca
gtagattggggtcgcccgtttgctgtattgcagggcttcggtatgcaaacgtccaatgtc
cagaccattattcgtcagaaagatgaacagctgcgtgctgcggtgtacgactctataagc
ggtaatttttcacaggctttttctcgtctgaaggattccgtttatgacatggaaaaacac
agcatactcgatgactatctggctctctctcaggcggatcgtgaaaaaacgttggtcatt
atccctgataatgagggtcgccaggactttaatgcgagcgtgcatgaaaagcgtgttaat
gatggtgaactatcggccaatgaagttgctgtgcgtagcctgctcagcgaaaaccttaat
gaagctgaacgtactgacagccggtattaccgatttggtcagattattgagtttcagctt
gatcacggtgagtttaagaaaggggagttctggaaggtagcagaggtttccggtaaggag
ttattgcttaaaagcggagatggtcaggaaaggaaattcaatccatctgaaattaccggt
aagtctaagtttgcgattgatgtctttcgggaggacaaaattctcttttctgaacaggaa
aaggttgtctttaccaagtcgcgcaaagatcttaacgtgcgtaacggtgatgaatttaaa
gtatcccgtatcgattcgacctcaggaacattcatcctcacagatgaaaaggggaaagag
ctttctctggactcatcaaaacttcataacatttcacatagttacgcaatgacgtcatac
aaggctcagggaaagactgtggatcgcgtgatggcgcaaatcgagtcctggcggcgcaat
ctggtcaacgagcgtagtttctatgtcaaccttagtcgcgcccgttacgaggctcggttg
tacgtggacaatgttgggaaagtaattaaagccctttctgaacatgacgccaataaaaca
acatcactcacgggtttttccaccaagagtatgaagcgagctgctgagcaccttcaggct
gaatctactgatacccggcagctgtatgccgatctgaacatagccactcaaaaactggca
aacaagcagggagtgtttagtcattctgcgttggtggctgagacgctgaaaaacacgctg
ggaacgtatgatgtcagagatatagagactgctatttacgccatgcgaatgcggggtgag
gtagggctttctcacattaatcatgaaaaagtgaatagtgagaattactacaccatgcca
cagaacattcgaaatgaagcccagattgtgcggcatatgctgcaaggtaaggatcgctat
gcgcccattgccgggaaatcggttgtcagtcgttatctttctgcgagagaagataaggcc
cggcagggaatagctgagcctgtctcagcggcgactcaggccgcgctgactacagtgatg
accagcagggatgaagctattctcatcaccggtagcgacctgagtggccatcgtgatgtt
atgagagaaattggcaaggatatcgccaaagagcggggatatcgtgtgaaaggattttcg
actactgccgagggggttaagcagatgcgtgaatctatgaagttctcagccaatatctac
cagcaccttgaccagatggaagctaagattgcggcaggtcaaatcgtccgaccaggtaag
gaactctgggtagtggaaaacgtttctcaaatgggggctgagaacgtgcttcgattgcag
caggcggcaaggtatgtcggggcgaggatggtgcttgtagccgaccgacaagagaactct
atagcttggggcaacatgccatcattgctggccgagcaggggatcgccaccattgatttt
gacaaggcgaatcgttcgctgaaccctgagattaacctggcaacagataagctgactcag
gggaaaattgaggacgcgcttgctcatgtcagtccgatgatgagtgaagtacgcgacctc
gataaccaaaacaatgatcgcacaatccggctgaatgttattgcaaactcttggttgaac
ctctcgccagaagaccgggctaaaaccgcaattgttatccctgactacttatctcgcaac
aaagttgatgtgcaaatacgcagaggccttcagtcagagggggttcttcagggtactcct
ttaacgacggcgctttatcgtaatgcgaatctcgatccatttgagaagaaggttgcgaca
aactacaagccaggccaggttgtgcagtttgaaagccagcgaccgggtatagagaagggc
gcatattataccgttgaggcggtgaacaaggccggtaatgagttgatactggtatcgctt
gaggcggggcatcgtgtaactattaacgcagctgatatcgctggtagccgtaacaactcc
gtgcaggtctttcatgtggagcaaaaacaaattcagaagggggaaaccctgcgtttcacg
cgcaccgttcccgctgacaagttagagagtgctgacggaaagggggtgtcgtccaaaatg
accggctcggtagtttcactcgacggcacgaaggttactctacgtcttgcaaataatcgg
caggtcacggtggacgcggccagctggaaacacatggagtggggatattccaataatatg
ttcaatatcaaagataaacagtttgataatgtgatcacgttgatggagtcatggaagaaa
cagtttgccactcaggaagcgcttcataacgcgctgaccaaaacggcggttaatctgcga
attatcactgatgataaagagaagctgcttgatagcctgcgcacaaatcccggtttcagg
caaacagcccttcaggatcgcaaggtatccattaccaaaagcgacatggccgcatttgat
aaacagtttggaacggggttgggctttggcatgcgatcactcatgaagctggaggctgcg
gtggacaaagcggttacttcaacagtaagcaaggtggttgagaaaacacgggaagttgcg
caaaagacgcggcaaaagtcgctgtaa

DBGET integrated database retrieval system