KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B117
Entry
ECL_B117          CDS       T01231                                 
Name
(GenBank) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 AAA_16 AAA_18 AAA_22 MMR_HSR1 ABC_tran RsgA_GTPase Viral_helicase1 AAA_5 Roc MeaB NTPase_1 AAA_10 DUF5906 AAA cobW AAA_33 TsaE AAA_19 RNA_helicase AAA_7 NB-ARC AAA_28 KTI12
Other DBs
NCBI-ProteinID: ADF65079
UniProt: A0A0H3CUY3
Position
pECL_B:complement(79145..81295)
AA seq 716 aa
MFVIATTAVTYQITDKTDWYMGLKYGYSYTLVELIGLKKGKTTLELPDGRKVMVRDAQIV
SSPTMQNHADALISNLIISLVISSIVALIAAWYLFRFILNKGKQESKDEHRRGAELATVK
ELIEAANDRVKEDGRLSRISIANVPLVRYQENSGIALLGSPGVGKSTIIRELLRQLRAQQ
RKAVLYDISGEFVKRFYRPGKDVILNVFDTRSHSWDFWAEGKNPAMYDRMAKAAIPDNNG
GGDPFWIEAPRLLFSALLEQLGKRYDVPSVEHLMNIILRMPNDKIANVVATTDARNVMNL
DLDKLAGSVRAVITAYTRNFKHLALPTGPRFSFKNWAQDEDSDAWVFITVRDDMKDTLKP
MITMMIESALSAILTLEPSQDRLIGTSIDEAGTLQEIPSLPDFMSTCRKFGGFPILGFQS
NAQTDVVYGEKKSQILMDGIGAIAAFRINGSKGAAWLADQLGDQETEKSSENTSYGANDV
RDATSINRQDKEGNLILRSQITALPDNTCYLKLGRGLPVAKIKFPYDYMKELHPGIIENE
ALNDTSFLSQLSKENEISPEHVVSIVNKENSREKREPQKFKQGSKPNPDAGKTQEQVLDE
VIDNSAPPDGSKTTSNADVSNPVAQAMSSVKSKTQMNAVAQAMNAANKKQSDADDQDDEG
DFSNLQFDTQVAHDFLAEYESSFSTEQSNTEKNSNNDVTNRNNEKSFDQHEYPGGM
NT seq 2151 nt   +upstreamnt  +downstreamnt
gtgtttgttattgccaccaccgccgtgacttaccaaatcactgataagactgactggtac
atggggttaaagtatggctactcctacacattagttgaactgattggtcttaagaaaggt
aaaaccacgcttgagctacctgatggccgtaaagttatggttagggatgctcagatagtt
agctcaccgacaatgcaaaatcatgcggatgcgctgatatccaacctgataataagcctt
gttatctcatcaattgtcgcacttattgcagcatggtatctcttccgatttattctcaac
aaaggcaagcaggaaagtaaggatgagcatcgtcgaggtgctgaacttgccactgtaaag
gaactgattgaagcagctaacgatagagtgaaggaagatggtcgtctttctcggatatct
atcgcgaatgtacctcttgtacgttatcaggaaaactctggcatagctcttttaggctct
ccgggtgtaggtaaatccaccattatcagggaattgctgcgccagctaagagcgcagcaa
agaaaggcagtgctttatgatatttcaggtgaatttgttaagcgtttttatcgtccggga
aaagatgtaattctgaacgtatttgatacccgatcacactcatgggatttctgggctgaa
gggaaaaacccggcaatgtatgaccgtatggcgaaagccgctataccagacaacaatggg
ggaggagatccattctggattgaggctccacgcttgttattttcggctttgctggaacaa
ctcggaaagcgctatgacgttccctcagtcgagcacttgatgaatatcattcttcgtatg
ccaaacgacaagattgccaacgttgttgctacgaccgatgctcgtaacgtcatgaattta
gatctcgacaaattggccggttcagtaagggctgttataaccgcttacacccgaaatttt
aaacaccttgctctccctaccggcccacgattttccttcaaaaattgggcacaggacgaa
gattctgatgcctgggtattcatcactgtgcgtgacgatatgaaggatactctcaagccg
atgattaccatgatgatcgaatctgccctgtctgcaattctgactctcgaaccatctcaa
gaccgtttaattggtacgagcatcgatgaagcaggtactcttcaggagatcccctcgcta
cctgatttcatgtcaacatgccgaaaatttggtggcttcccaatcttgggctttcagtcc
aatgctcagactgatgttgtctacggggaaaagaaaagtcagatcctgatggatggtatc
ggtgcaatagccgcttttcgtatcaatggtagtaaaggggctgcatggttagctgaccag
ttgggtgatcaggagacggagaaatcgtcggaaaatacaagctacggcgcaaatgatgtt
cgtgatgcaacatcgataaatcgtcaggacaaagaaggaaatctaatcctgcgaagccag
atcacagcattgccggataacacctgttatctgaagttaggtcgcggcttgcctgtagca
aaaatcaagttcccttacgactatatgaaggagctgcatccaggcatcattgaaaatgaa
gcattaaacgacacctccttcctttcgcagttgtccaaagagaatgagatttcccctgaa
catgtagtcagtatcgttaacaaagaaaactccagagagaagcgtgaaccgcagaagttc
aaacaagggagtaagccaaaccctgatgcgggtaaaacgcaggagcaagtcctggatgaa
gttattgataactctgcaccgccggatggcagtaagacgacgtcgaacgccgatgtttcg
aatcccgtcgcgcaggccatgtcatctgtaaagtcgaaaacgcagatgaatgcagttgct
caggctatgaacgctgcaaataagaaacagtctgacgcagatgatcaggatgatgaaggg
gatttctctaaccttcaatttgatacgcaggttgctcacgattttctggcggagtatgaa
agttcattctcaactgagcaatcaaatacggagaaaaacagtaacaatgacgtgactaat
cgaaataatgagaagtcatttgaccagcatgaatatccaggaggcatgtaa

DBGET integrated database retrieval system