KEGG   Enterococcus faecalis 7L76: ENT_06000Help
Entry
ENT_06000         CDS       T02585                                 

Definition
(GenBank) Glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
ene  Enterococcus faecalis 7L76
Pathway
ene00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ene00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ENT_06000
Enzymes [BR:ene01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     ENT_06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn Pantoate_ligase DUF4434
Motif
Other DBs
NCBI-ProteinID: CBL31378
UniProt: A0A1G1SEQ6
Position
575973..576371
Genome map
AA seq 132 aa AA seqDB search
MKKILTYGTFDLLHYGHINLLKKAKQQGDYLIVGLSTDAFNLEKKKQSYFSYEKRKQLLE
AIRYVDLVIPETSWKQKVSDIAEFKIDTLVMGDDWQGAFDFLEVETTAKVLYLPRTPEVS
TTQIKKELYYSE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacttacttacggcacatttgacctcctgcactatggtcatattaatttg
ttgaaaaaagcgaaacaacaaggggactacctgattgttggactatcaacagatgctttt
aatttagaaaaaaagaaacaaagttatttttcatatgaaaaacgtaaacaattattagag
gcaattcgttatgttgatttagttattcctgaaactagttggaaacaaaaagtttccgat
attgctgaatttaaaattgatactttagtcatgggcgatgattggcaaggggcttttgat
tttctagaagttgaaacaaccgcaaaggttctttatttgccacgaacgccagaagtatca
accacacagataaaaaaagaattatattatagtgaataa

DBGET integrated database retrieval system