KEGG   Enterococcus faecalis 7L76: ENT_17460Help
Entry
ENT_17460         CDS       T02585                                 

Definition
(GenBank) Selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ene  Enterococcus faecalis 7L76
Pathway
ene00450  Selenocompound metabolism
ene01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ene00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ENT_17460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ene03016]
    ENT_17460
Enzymes [BR:ene01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     ENT_17460
Transfer RNA biogenesis [BR:ene03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ENT_17460
 Prokaryotic Type
    ENT_17460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS Mitofilin
Motif
Other DBs
NCBI-ProteinID: CBL32193
Position
complement(1714239..1714601)
Genome map
AA seq 120 aa AA seqDB search
MDFLSQCTSGGCGSKIESRVLNQLLQHLPETPANERLLVGFEHADAAAVYQITSEKALIS
TVDFFSPMVNDPLSFGKIAVANALSDVYAMGGTVLYALNLVCFPQKMSKEWLEQMLLGAV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggattttttatcacaatgtacatcaggtggctgcgggtcaaaaattgaatcccgtgta
ctgaaccaattgttgcaacacttacccgaaacaccggcaaatgagcggctactcgtcgga
tttgaacatgccgacgccgccgctgtttaccaaataacgtctgaaaaagctttgatttca
acggtagattttttttcaccaatggtcaatgatccgttatcatttggaaaaattgcggtc
gctaatgctttaagtgatgtctatgccatgggcggtacagtcctctatgcgttaaatctt
gtttgttttccacaaaagatgtcaaaagaatggttggaacaaatgctcttgggtgcagtt
taa

DBGET integrated database retrieval system