KEGG   Enterobacter sp. FY-07: AKI40_0050Help
Entry
AKI40_0050        CDS       T04405                                 

Definition
(GenBank) Oxygen-insensitive NADH nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00633  Nitrotoluene degradation
enf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AKI40_0050
Enzymes [BR:enf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AKI40_0050
  1.-  
   1.-.-  
    1.-.-.-  
     AKI40_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AMO46481
UniProt: A0A127KW31
Position
complement(62970..63623)
Genome map
AA seq 217 aa AA seqDB search
MTLDDAVIARHTVKAFEPGKTLPQEKIDTLLNVLRNSPSSVNSQPWHFVVASTPEGREAI
AKSTSGAYAYNEPKVLNASHVIALCMRSDLDDQHLQNVLAQEQKDGRFVAEGAQAGQDKS
RRSYVDMHRYEQRDIPQWMEKQVYLALGGLLLSAAMLDIDATPMEGFDQRALDLALGLRE
KGLTSVVLVSLGFRSEKDFNAALPKSRLPRDEIFTFI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgatgatgctgtgattgcccgccatacggtgaaagcgtttgaacccggtaaa
acgctgccgcaggaaaaaattgacaccttacttaacgtgctgcgaaacagcccctcgtct
gtgaattcacagccgtggcactttgtggtcgcctccacgccggaaggccgcgaagcgata
gcgaaatccaccagcggtgcgtatgcctataacgaaccgaaagtgctgaatgcctctcat
gtcatcgccctgtgcatgcgcagcgatctcgatgaccagcatctgcaaaacgtgctggcg
caggagcaaaaagatggccgctttgtcgctgaaggcgcacaggccggtcaggacaagagc
cgccgctcttatgtggatatgcaccgctatgagcagcgcgatattccgcaatggatggag
aaacaggtttacctggcgctgggcggcctgctgctgagcgccgcgatgctcgacattgac
gccacgccgatggaagggtttgatcagcgcgcgctggaccttgcactgggtctgcgtgag
aaagggctgaccagcgtggtgctggtctcactgggctttcgcagcgaaaaagactttaac
gctgcactgccaaaatcccgcttaccgcgtgacgagatttttacctttatctaa

DBGET integrated database retrieval system