KEGG   Enterobacter sp. FY-07: AKI40_0903Help
Entry
AKI40_0903        CDS       T04405                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00071  Fatty acid degradation
enf00072  Synthesis and degradation of ketone bodies
enf00280  Valine, leucine and isoleucine degradation
enf00310  Lysine degradation
enf00362  Benzoate degradation
enf00380  Tryptophan metabolism
enf00620  Pyruvate metabolism
enf00630  Glyoxylate and dicarboxylate metabolism
enf00640  Propanoate metabolism
enf00650  Butanoate metabolism
enf00900  Terpenoid backbone biosynthesis
enf01100  Metabolic pathways
enf01110  Biosynthesis of secondary metabolites
enf01120  Microbial metabolism in diverse environments
enf01130  Biosynthesis of antibiotics
enf01200  Carbon metabolism
enf01212  Fatty acid metabolism
enf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKI40_0903
   00630 Glyoxylate and dicarboxylate metabolism
    AKI40_0903
   00640 Propanoate metabolism
    AKI40_0903
   00650 Butanoate metabolism
    AKI40_0903
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKI40_0903
   00072 Synthesis and degradation of ketone bodies
    AKI40_0903
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKI40_0903
   00310 Lysine degradation
    AKI40_0903
   00380 Tryptophan metabolism
    AKI40_0903
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKI40_0903
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKI40_0903
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKI40_0903
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enf04147]
    AKI40_0903
Enzymes [BR:enf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKI40_0903
Exosome [BR:enf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKI40_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AMO47326
UniProt: A0A127KYJ1
Position
922812..923993
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSRHSAVELGSLVVQALVERSGVQPQDIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLASQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAPLGNSQLIDSLVHDGLWDAFNDYHMGMTAENLAREYGISREHQDEWAL
RSQHKARAAIDSGRFRAEIVPVNAIAADGRAVIVDTDEQPRTDPSAEALARLSPAFGVSG
SVTAGNASPLNDGAAAVLMMSENKAQAMNLPVLARIRAFASVGVDPALMGIAPVYAMRRC
LDRAGWQLNDVDLIEANEAYAAQALSVGKVLEWDEKRVNVNGGAIALGHPIGASGCRILV
SLVHEMQKRNARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatcgtgggggctgtccgcacgccaatcggctgttttcagggggcc
ttgtcgcgccactccgccgttgagctcggtagtctggtagtgcaggcgttggtggaacgc
agcggtgtgcagccacaggatattgatgaagtgatcctgggccaggtgttaactgccgga
gccgggcaaaatcctgcgcgccagtcggctattaaaggtgggttaccgaataccgtttcc
gccatcactattaacgatgtttgcggttcagggctaaaagccctgcatctggcctcgcag
gctattcagtgtggcgaggcagatgtggtgattgcaggcggccaggaaaatatgagtcgt
gcgccgcatgtgctcaccgacagccgaaccggtgcgccgctgggcaatagccaactgatt
gatagtctggtgcacgacgggctgtgggatgcgttcaacgattaccatatgggaatgacg
gcggaaaatctggcgcgcgagtatggcatcagccgcgaacatcaggatgaatgggcactc
cgttcccagcataaagcgcgcgcggccattgattcaggtcgctttcgtgctgagattgta
ccggtgaacgcgattgccgcagatggtcgggcggtgattgttgatactgatgaacagccg
cgtaccgatcccagtgccgaagcgctggcaagattgtctccggcttttggcgtgagtggc
tcggtcaccgccggtaacgcttcgccattgaatgatggcgcggcggcagtattgatgatg
agcgagaacaaagcgcaggcgatgaatctgccggtgctggcgcgtattcgggcatttgcc
agcgttggcgttgatccggcgttgatggggatcgcgcccgtctatgcgatgcgacgttgt
ctggatcgtgcaggctggcagttaaatgatgttgacctgattgaagcgaacgaagcctac
gcggcgcaagcgttgtcggtggggaaggtcctcgaatgggacgagaaacgcgtcaatgtc
aacggtggcgcgatcgcgttgggtcatccgattggcgcatccggttgccgtattctggtt
tccctggtgcacgagatgcaaaagcgcaacgcgcgcaaagggctggcgacattatgcatt
ggcggtggtcagggcgtggcgctggctattgaacgcgattga

DBGET integrated database retrieval system