KEGG   Enterobacter sp. FY-07: AKI40_0942Help
Entry
AKI40_0942        CDS       T04405                                 

Gene name
recC
Definition
(GenBank) Exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:enf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AKI40_0942 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:enf03400]
    AKI40_0942 (recC)
Enzymes [BR:enf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AKI40_0942 (recC)
DNA repair and recombination proteins [BR:enf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AKI40_0942 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AMO47365
UniProt: A0A127KYP0
Position
962566..965937
Genome map
AA seq 1123 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERDPLDDPFEPEVVLVQSTGMAQWLQMTLAQKFGIAANI
TFPLPASFIWDMFVSVLDDIPKESAFNKQSMSWKLMSLLPGMLQREEFAMLHHYLSDDDD
KRKLFQLSSRVADLYDQYLVYRPEWLTRWEAGQSVDGLDEAQRWQAPLWRALVEHTAALG
QPHWHRANLYQRFIDKLESAQARPAGLPSRVFICGISALPPVYLQALQALGKHIDVHLLF
TNPCRYYWGDIKDPAFLAKLITRQRRHHREARQFPLFRDSQTAGSLFNDEGEQDVSNPLL
GSWGKLGRDNIFLLAGMERYEELDAFVDITPGTLLQNIKYDILELKNAAVAGVTAEEFSR
SDKKRRLQPGDRSVTVHVCHSPQREVEILHDRLLAMLDADPDLTPRDIVVMVADIDSYSP
YIQSVFGSASGERYVPYAISDRRARQAHPALQAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFNINEEGLRYLRLWVNESGIRWGMDDDNVRELALPPTGQHTWQFGLTRMLLGYAMESR
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCREMLNDFFL
PDPDTEAALALIEQQWQEIIAKGVGANYGEAIPLSLLRDELAQRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRTLPPLGFDLMSQKPQRGDRSRRDDDRYLFLEAL
ISAQQQLYISYIGRAIQDNKERFPSVLVQELVDYIGQSHYLPGDEAANCDESEARVKAHI
THLHTRMPFDPANYVADEWQSYARDWLPAANQQGETHPAFIQPLAPLPLQTLAFDQLQRF
WAHPVRAFFQMRLQVNFRPEESEIPDAEPFVLDGLSRYQLNNELLNALVEQQDAEKLFRR
YRAAGALPYGAFGEIFWETQCQEMQALASRVSELRQPADSLEIDLHCAGVHLTGWLPRVQ
ADGLLRWRPSLLSVSQGVQLWLEHLVYCASGGTGESRLFVRKDGEWRFPPLEPDHAMHYL
ALMIDGYREGMAKPLLLLPESGGAWIKVCYDAANDAMVMDDETLQKAQGKFLQAYEGNMM
VRGEGDDLWYQRLWRTLEPEYYAEITEQAQRFLLPLYRHNQSG
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtttatcactccaatcgtctggatgtgctggaagcattgatggagtttatt
gttgagcgcgatccgcttgacgatccctttgagcctgaggtcgtcctggtgcagagcacc
ggtatggcgcaatggctgcaaatgacgctggcgcagaaatttggcattgccgccaatatc
acgtttcctcttccggcgagctttatctgggacatgttcgtcagtgtgctggacgatatt
ccgaaagagagtgcgtttaacaaacaaagtatgagctggaaactgatgtcgctgctgcca
ggcatgttgcagcgcgaagagttcgcgatgctgcatcattacctgagtgacgatgatgat
aagcgaaagctctttcagctctcttcccgtgtggcggatctctatgaccaataccttgtt
taccgcccggagtggctaactcgctgggaggcggggcagagcgtagatggtctggatgag
gcgcaacgctggcaagcaccgttatggcgtgcgttggtggagcacactgccgctctcggt
cagccacactggcatcgcgctaatctgtatcaacgttttatcgataaactcgaatcagcc
caggcgcgtcccgcaggacttccctcccgggtttttatttgtgggatttccgctctgccg
ccggtttacctgcaagcattacaggcattgggtaagcatatcgatgttcacctgctattc
actaacccttgtcgctactactggggcgacatcaaagatcccgcatttttggcgaaactt
atcacccgccagcgtcgacatcaccgggaagcccggcagtttccgctgtttcgggattcg
caaactgccggcagtttattcaacgacgagggagaacaggatgtcagtaacccgctgctt
ggctcatggggcaaactgggtcgtgacaatatctttttgttggcgggaatggaacgctac
gaggaactggatgcgtttgtcgatataacgcctggtacactgctacaaaatattaaatac
gacattcttgaattaaaaaacgccgctgtagccggggtgaccgcagaagagttttcccgc
agcgataaaaaacgcaggctacaaccgggcgatcgtagcgttacggtacatgtctgtcac
agcccacagcgggaagttgagatcttgcacgatcgtttactggcgatgctggacgccgat
cccgatctgaccccgcgcgatatcgtggtgatggtggcggatattgatagctacagtcct
tatattcagtcggtgtttggcagcgccagcggtgaacgctatgtgccttatgccatttcc
gaccgtcgcgcccgccaggcgcacccggcgttgcaggcgtttattagcctgctgtcgttg
ccagacagccgtttcgtgtcagaagatgtgctggcgttgttggatgtgccggtactggct
gcacgtttcaacatcaacgaagaggggctgcgctatttgcgcctgtgggtaaacgagtcg
ggcattcgctgggggatggatgacgataatgtgcgcgaactggcgttgccgccaaccggt
cagcacacctggcagtttggtctcacgcgtatgcttctgggttacgccatggagagtcgt
caaggcgagtggcagtctgttctgccttacgatgaatccagcgggctgatcgcagaactg
gtgggtcacctggcgtcactgctgatgcaactgaatatctggcgccgtgggcttgcgcag
gaacgcccgctggaggagtggttgccggtttgccgtgaaatgctgaacgattttttcttg
ccggatccggacaccgaagcggcgcttgcgctgatcgaacagcagtggcaggagatcatc
gccaagggcgtgggagcaaactacggtgaagcaatccccctttctttgttgcgtgatgaa
ctggcgcagcgcctggatcaggagcgtatcagtcagcgttttcttgcaggaccagttaat
atctgcactctgatgccgatgcgttcgatcccttttaaggtggtctgcttactggggatg
aacgatggcgtttatccgcgaacgctgccgccgctggggtttgatttaatgagtcagaaa
ccccagcgtggcgatcgtagtcgtcgtgatgatgaccgctatctgttccttgaagcgctg
atttccgcacaacagcagctctatatcagctatatcggtcgtgccattcaggataacaaa
gaacgtttcccttcggtgctggtgcaggaactggtggactacatcggtcaaagtcactat
ctgcccggtgatgaggccgcgaactgcgatgagagtgaagcgcgggtgaaggcgcatatc
actcatctgcatacccgtatgccgttcgaccccgcgaattatgttgctgatgagtggcag
agctatgcacgcgactggttgccggccgcaaaccagcagggcgaaacacatcctgctttt
attcagccgctggcaccactaccgctgcagacgctggcctttgaccagcttcagcgtttc
tgggcgcacccggtacgcgcttttttccagatgcggttacaggttaacttccgcccggaa
gagagtgaaattccggatgcggaaccttttgtgctggatgggctaagccgttatcaactg
aataatgaactgcttaacgcgctggttgaacagcaggatgcggaaaaattgttccggcgt
taccgggcagcgggtgcactgccttatggcgcctttggcgagatcttctgggagacgcaa
tgccaggagatgcaggcactggccagccgtgtcagcgagttgcgccagcctgccgatagc
ctcgaaatcgacttacattgtgccggtgtacatttaaccggctggttgccgcgcgtacag
gcagatggcctgctacgctggcggccctcgctattgagcgtttctcaaggggtgcaactt
tggctggagcatcttgtctactgtgccagcgggggaaccggcgagagccgactgtttgtg
cgcaaagatggcgagtggcgcttcccgcccctggagcctgaccatgcaatgcattatctg
gccctgatgattgacggataccgggaaggcatggcaaaaccgttattactgctgccggaa
agcggcggtgcatggataaaagtctgttatgacgcggcaaatgatgccatggtaatggat
gacgaaacgttacaaaaagcgcagggcaaatttctgcaggcgtacgaaggcaatatgatg
gttcgcggcgaaggcgatgatctctggtatcagcgtctgtggcgcacccttgaacctgaa
tattatgcagaaatcactgaacaggcgcagcgtttcctgttaccgctttatcggcataat
cagtctggttga

DBGET integrated database retrieval system