KEGG   Enterobacter sp. FY-07: AKI40_1544Help
Entry
AKI40_1544        CDS       T04405                                 

Gene name
hisP
Definition
(GenBank) ABC amino acid transporter, ATPase subunit
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:enf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AKI40_1544 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enf02000]
    AKI40_1544 (hisP)
Enzymes [BR:enf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AKI40_1544 (hisP)
Transporters [BR:enf02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AKI40_1544 (hisP)
   Histidine transporter
    AKI40_1544 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_16 ABC_ATPase AAA_23 G-alpha PRK AAA_33 AAA_24 RsgA_GTPase ATPase_2 DUF87 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AMO47956
UniProt: A0A127L0B4
Position
1568083..1568856
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVNGQNINLVRDKDGQLKVADKHQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDEMQQQKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEEVF
TNPKSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataaattaaacgttatcgatttacacaagcgctacggtgagcatgaagtg
ctgaaaggcgtgtcgttgcaggccaatgcgggtgatgtgatcagcatcattggctcttcc
ggctccggcaagagtacgtttttacgctgtattaacttcctcgaaaaaccgagcgaaggc
tcgatcgtcgtgaacgggcagaatatcaacctggtgcgcgacaaagacggtcaactgaaa
gtggccgataagcaccaactgcgcttgttacgtacccggctgaccatggtgttccagcat
tttaacttgtggagccatatgacggtgctggagaacgtgatggaagcgccgatccaggtg
ctgggcttaagcaagcaggaagcccgcgaacgtgcggtgaagtacttggcgaaggtcggc
atcgacgaaatgcagcagcaaaaatacccggtgcatctctccggcggccagcagcagcgt
gtatccattgcccgtgcactggctatggagccggaagtcctgctgtttgacgaaccgact
tcagcgctggatccggagctggtgggcgaagtgctacgcattatgcaacagctggcggaa
gaggggaaaacgatggtggtggtgacccacgaaatggggttcgcgcgccatgtttccacc
cacgttatcttcctgcatcagggcaaaattgaagaggaaggcgcgccggaagaggtgttt
accaacccgaaaagcccgcgtttgcagcagttcctcaaaggctcattgaaataa

DBGET integrated database retrieval system