KEGG   Enterobacter sp. FY-07: AKI40_2125Help
Entry
AKI40_2125        CDS       T04405                                 

Definition
(GenBank) Alpha ribazole-5'-P phosphatase in cobalamin synthesis
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00860  Porphyrin and chlorophyll metabolism
enf01100  Metabolic pathways
Module
enf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AKI40_2125
Enzymes [BR:enf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AKI40_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 STAG
Motif
Other DBs
NCBI-ProteinID: AMO48530
UniProt: A0A127L1Z6
Position
complement(2138854..2139753)
Genome map
AA seq 299 aa AA seqDB search
MILNVRVTLSQRQIVLQGVFERCRHTGRVNIGAEIEKLLRGNAQECSSLTGIAAMRAMKQ
SHLPLRSKTTILNEKDEWIEDAVLNFAQKSRRETIMRLWLIRHGETEANVAGLYSGHSPT
PLTAKGIAQARTLHGLLRAVPFDHVLCSELERARHTAQQVLENRDVTVHTTALLNEMFFG
DWEMRHHRDLTREDPESYAAWCTDWQNAIPTNGEGFQAFSLRVEQFIATLTDLRQHQNVL
VVSHQGVLSLLIARLLNMSASSLWHFRVDQGCWSAIDIHDDFATLRVLNSRATWQMDET
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgatactcaacgtccgggtaacgctcagccaacgccagattgttttgcaaggcgtgttt
gagcgatgccggcataccggccgggttaatattggcgctgaaatcgagaagttgctccgg
ggcaatgcccaggagtgcagcagcctcacgggtattgccgccatgcgcgctatgaaacaa
agccatcttccgctccggtcaaaaacgacaatcttaaacgaaaaagacgagtggattgag
gatgcagtgttaaactttgcgcagaaatcgagacgggagaccattatgcgactctggctg
atacgtcatggtgaaaccgaagcgaatgttgcagggctctacagcggccattcaccaacg
ccattgacggcaaaagggattgcccaggcacggacacttcatggcttgctgcgggctgtt
cccttcgatcatgtattatgcagcgagcttgaacgggcacggcacactgcgcaacaggtg
ctggaaaatcgtgatgtcacggtgcacaccacggcgctgctcaatgagatgttttttggt
gattgggagatgcgccatcaccgcgatttaacgcgcgaagatccggagagttatgctgcg
tggtgtacggactggcagaatgcgattccgacgaacggcgaaggttttcaggctttctcc
ctgcgcgtggaacagtttatcgccacgcttaccgatctccgtcaacaccagaatgtactg
gtggtcagccatcagggtgtgctgagtttattgattgcccggctgttaaacatgtcggct
tcctcgctgtggcattttcgcgttgatcaagggtgctggagtgcaattgatattcatgat
gatttcgccacgcttcgcgtattaaatagccgcgccacctggcagatggacgagacatag

DBGET integrated database retrieval system