KEGG   Enterobacter sp. FY-07: AKI40_3025Help
Entry
AKI40_3025        CDS       T04405                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00010  Glycolysis / Gluconeogenesis
enf00053  Ascorbate and aldarate metabolism
enf00071  Fatty acid degradation
enf00280  Valine, leucine and isoleucine degradation
enf00310  Lysine degradation
enf00330  Arginine and proline metabolism
enf00340  Histidine metabolism
enf00380  Tryptophan metabolism
enf00410  beta-Alanine metabolism
enf00561  Glycerolipid metabolism
enf00620  Pyruvate metabolism
enf00625  Chloroalkane and chloroalkene degradation
enf00903  Limonene and pinene degradation
enf01100  Metabolic pathways
enf01110  Biosynthesis of secondary metabolites
enf01120  Microbial metabolism in diverse environments
enf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AKI40_3025
   00053 Ascorbate and aldarate metabolism
    AKI40_3025
   00620 Pyruvate metabolism
    AKI40_3025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKI40_3025
   00561 Glycerolipid metabolism
    AKI40_3025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKI40_3025
   00310 Lysine degradation
    AKI40_3025
   00330 Arginine and proline metabolism
    AKI40_3025
   00340 Histidine metabolism
    AKI40_3025
   00380 Tryptophan metabolism
    AKI40_3025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKI40_3025
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AKI40_3025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AKI40_3025
Enzymes [BR:enf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AKI40_3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1304 DUF433
Motif
Other DBs
NCBI-ProteinID: AMO49410
UniProt: A0A127L4E0
Position
3038991..3040406
Genome map
AA seq 471 aa AA seqDB search
MQSVEHISINGKWVTPQGTERFDLFNPATGDVTGQVRLANEADALNAIAAAKAAFPAWSQ
TRVGERVEALTRMREALAACEEELLQAIVQEYGAPAARAVWMARYPVAVIDQVISDLQQF
VFTSQVGHARVEMTPLGVAGLITPWNSNAGFICGKLAAALAAGCTAVIKPSEMSAWQTQV
VTRALHQAELPPGVFNIVTGRGEVVGEVMSRHPDIAKISFTGSTMTGKAILRNAADTFKR
VTLELGGKSPTLILDDADPATAVPLAIQAGFINSGQACIAGTRILVPNSRKAEYEAALAQ
AVASVKSGDPHDPANDIGPMVSEKQWQRVQSYIRLGQQEGARVLAGGEGRPENSGQGWFV
RPTLFTDVENTMRIAREEIFGPVLSVIGYQDDAHAVAIANDTDYGLSALVLGRDVERAQQ
VAAQIHAGRVQVNTLAHEAGAPFGGFKHSGIGREMGRWGLAAFMEPKTLVM
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgttgaacatatttccattaacggcaaatgggtgacgccgcaaggcacagaa
cgttttgacctgtttaatccggcgactggcgacgtcactggtcaggtgcgtctggcaaac
gaagccgatgcgctgaacgccattgccgcagcaaaagccgcgtttccagcctggtcgcag
acccgtgtcggggagcgagtcgaggcgctgacgcgcatgcgtgaggcattagcggcgtgt
gaagaggagttgttgcaggccattgtgcaggagtatggcgcgcctgccgcccgcgcagtc
tggatggcacgctaccctgtggcggttatcgatcaggtgataagcgatctgcagcagttt
gtgtttacctcacaggttggccacgcgcgtgtggagatgacaccgctgggtgtggccggt
cttatcactccgtggaacagcaatgcgggatttatctgcggcaagcttgccgccgcgttg
gcggcggggtgtacggcggtgatcaaacccagcgagatgagcgcatggcaaacccaggtg
gtgactcgcgcattgcatcaggcggaactgccgcccggcgtgtttaatattgtcaccggg
cgcggcgaggtggtgggcgaggtgatgagccgtcacccggatatcgcaaaaatctcgttc
accggctcaaccatgacgggcaaagcgatcctgcgtaatgccgctgacacctttaaacgg
gttactttggagctgggcggtaaatcgcccaccctgatcctggatgatgccgatcccgcc
accgccgtgcctttagcgatacaggcggggtttattaacagcggtcaggcctgtattgct
ggcacgcgtattctggtgccgaattcacgtaaggccgagtatgaagcggcgttggcgcag
gcggttgcgtcggtaaaatcaggcgacccgcatgatccagctaacgatatcgggccgatg
gtcagtgaaaaacagtggcagcgtgtgcagtcgtacattcgccttgggcagcaggaaggg
gcgcgagtactggcgggcggtgaagggcggccagaaaatagcgggcaggggtggtttgtc
cgcccgacgttgtttacggatgtggagaacacaatgcgcattgcccgtgaagaaattttt
ggcccggtgttatcggtgatcggttatcaggatgatgcgcatgcggtggcgatcgccaat
gacacggattatggattaagtgcgttggtactgggtcgcgatgttgaacgtgcacagcag
gtggcggcgcaaattcacgccgggcgtgtgcaggtgaacacgctggcgcatgaggccggt
gcgccgttcggtggttttaaacactcaggcattgggcgggaaatggggcgctggggatta
gcggcgtttatggagccgaaaaccctcgtcatgtaa

DBGET integrated database retrieval system