KEGG   Enterobacter sp. FY-07: AKI40_4061Help
Entry
AKI40_4061        CDS       T04405                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
enf  Enterobacter sp. FY-07
Brite
KEGG Orthology (KO) [BR:enf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:enf03016]
    AKI40_4061
Enzymes [BR:enf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AKI40_4061
Transfer RNA biogenesis [BR:enf03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AKI40_4061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AMO50438
UniProt: A0A127L7C6
Position
complement(4139490..4140284)
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHRIQKRYHAVVRGWLMEDALLDYPLVEELDKVADKFARTDK
GPQPAVTHYRGLATTEMPVATGKFPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFGCNRLMLHASQLTLTHPFTGEALTLRAGLDDVWMRAVSQFGWQGLL
PDNERVEFSGLSVHDEKNQTSPKE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatttaccaggatgaatggctggtcgcggtcaacaagccatcgggctgg
ctggtacaccgtagttggctggatcgcgacgaaaaagtcgtggtgatgcaaacggtgcgt
gaccaaatcggccagcacgttttcaccgcgcaccgtctcgacaggccgacttccggcgtt
ttgctgatggggttatccagcgaagcggggcgtctgctcgcacagcagtttgagcaacac
cggatccagaagcgttatcacgcggtggtgcgtggctggctaatggaggacgcgttgctt
gattatcccttggttgaagaactcgataaagttgcggataaattcgcccgcaccgataaa
ggcccgcaaccggccgtgacccattatcgcgggctggcgaccaccgagatgcccgttgcc
actggcaagttcccgactacccgctatgggttggttgaactggagccaaaaaccggccgt
aaacatcagctgcggcgccatttagcccatttgcgccatccgattattggtgacagcaag
cacggggatttgcggcaaaaccgcagcgcagcggaacactttggttgcaaccggttaatg
ctgcacgccagccagttaacgctgacgcatccgtttaccggcgaagcattaacgttgcgc
gccgggctggatgatgtctggatgagggcagtgtcgcagttcggctggcaaggacttctc
cctgataatgaaagggttgagttctccggtctgagcgttcacgatgagaaaaatcagaca
tcacccaaggagtga

DBGET integrated database retrieval system