KEGG   Enterobacter sp. FY-07: AKI40_4245Help
Entry
AKI40_4245        CDS       T04405                                 

Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K03774  FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC:5.2.1.8]
Organism
enf  Enterobacter sp. FY-07
Brite
KEGG Orthology (KO) [BR:enf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:enf03110]
    AKI40_4245
Enzymes [BR:enf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AKI40_4245
Chaperones and folding catalysts [BR:enf03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    AKI40_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AMO50621
UniProt: A0A140IF65
Position
complement(4345359..4345889)
Genome map
AA seq 176 aa AA seqDB search
MGRIALCHPAMKMQPGSITAQNIRATCMSKSVQSDSAVLVHFTLKLEDGSLAESTRNNGK
PALFRLGDGSLSEGLEQHLLGLKAGEKKAFSLEPDAAFGTPSPDLIQYFSRREFMDAGEP
EVGAIMLFTAMDGSEMPGVIREVNGDSITVDFNHPLAGRTVHFDIDVLEVDPALEA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgggccggatagcgttgtgtcatccggcaatgaaaatgcaaccgggcagtatcactgct
caaaacataagagcaacctgcatgtctaaatccgtacaaagcgatagcgcagtgctggtg
cactttacgctgaaacttgaagatggctctcttgctgagtcaacccgcaataacggcaaa
ccggcgttgtttcgccttggtgacggttcactttccgaagggctggaacaacatctgctg
ggtttgaaggccggtgagaaaaaagcgttctctctcgagccggacgccgcatttggtacg
ccgagcccggacctgatccagtatttctcccgtcgtgagtttatggacgccggagaacct
gaagttggtgcgattatgctttttacggcaatggacggcagtgaaatgcccggcgtgatc
cgtgaagtcaacggcgactctattaccgttgattttaaccacccgctggcgggcagaacc
gtccattttgatatcgatgtgctggaagtcgatccagcgctggaggcataa

DBGET integrated database retrieval system