KEGG   Enterobacter sp. FY-07: AKI40_4839Help
Entry
AKI40_4839        CDS       T04405                                 

Gene name
gldA
Definition
(GenBank) Glycerol dehydrogenase, NAD
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00561  Glycerolipid metabolism
enf00640  Propanoate metabolism
enf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AKI40_4839 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AKI40_4839 (gldA)
Enzymes [BR:enf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AKI40_4839 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AMO51212
UniProt: A0A140IGV6
Position
4974396..4975499
Genome map
AA seq 367 aa AA seqDB search
MDRVIQAPGKYIQGADVITRLGDYLKPLSDRWLVVGDKFVLGFAQEALQKSLADAGLACE
VVPFGGECSQNEIDRLRSVAKNAHAGAILGIGGGKTLDTAKALAHFMQIPVAIAPTIAST
DAPCSALSVIYTDNGEFDRYLLLPNNPNRVIVDTKIVAGAPPRLLAAGIGDALSTWFEAR
ACSRSGAKTMAGGQCTQAALALAELCYNTLIEEGEKAMLAAGQHVVTPALERVVEANTYL
SGVGFESVGLAAAHAIHNGLTAIPDAHHFYHGEKVAFGTLTQLVLENAPMEEIETVAALC
HTVGLPITLAQLDIKTDIPAKMRIVAQAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLGEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgtcatccaggcgccaggtaagtacatccagggtgcagacgtcatcacccgt
ctcggcgactatctcaaaccgctgtccgaccgctggctggtcgtcggcgacaagtttgtt
ctcggtttcgctcaggaagcgctgcaaaaaagtctggcggatgccgggctggcatgcgag
gtggtgcccttcggcggcgaatgttcacaaaatgaaatcgacaggctacgcagcgtagcg
aaaaacgcccatgccggagcgatactgggcatcggcggcggtaaaacgctggataccgcc
aaagcgctggcgcatttcatgcagatcccggtggcgattgcgcccaccatcgcttctacc
gacgcgccctgtagcgccctgtcggtcatctacaccgataacggtgaattcgaccgctat
ttgttgctgccgaacaatcccaatcgtgtgatcgtcgataccaaaatcgtcgcgggtgca
ccaccgcgtctgctggctgcggggattggcgatgccctctctacctggtttgaagcccgc
gcctgctcgcgcagtggcgcaaaaaccatggcgggtggacagtgtacacaagccgcactg
gcgctggcggaactctgctacaacacgctgatagaagagggtgaaaaagcgatgctggcc
gccgggcaacatgtggtaacgcccgcactggaacgcgtggtggaagcgaacacgtacctc
agtggtgtcggttttgagagcgttggtctggcggcggcgcacgctatccacaacggttta
accgcgatcccggacgctcatcacttttatcacggtgagaaagtggcatttggcacgtta
acgcaactcgtgctggaaaacgcgccgatggaagagatcgaaaccgttgcagcgctgtgt
cataccgtgggcctgcccatcacgctggcgcaactggatatcaaaaccgatattccggcg
aaaatgcgcattgtggcgcaggcggcctgcgctgaaggggaaaccattcacaatatgccg
ggcggcgcgacgccggatcaggtgtatgccgcactgctggtcgccgaccagtacggtcag
cgtttcttaggtgagtgggaataa

DBGET integrated database retrieval system