KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_00875Help
Entry
A3UG_00875        CDS       T02159                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00051  Fructose and mannose metabolism
enl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A3UG_00875
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     A3UG_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFM57928
Position
complement(174401..175549)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHSYQVHVVGENEQVETV
SGVNAVSSIGDDVIDLIASVDLVTTAVGPVVLERIAPAVAKGLAKRKAQGIDTPLNIIAC
ENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRIVPPSESATNDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSEQDPQAQELAQLIDEKGAQAALAQ
ISGLDANSDVVAEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gcagacgcgggcattacgctgacattcgccgatgtgaatcaggtcgttctggatgccctg
aatgcccgtcatagctaccaggtacacgtggtgggagaaaacgagcaggttgaaacggtc
tctggcgtcaacgcggtaagcagcattggtgacgatgttatcgacctcatcgccagcgtt
gatctggtgaccaccgcggtgggcccggtggtacttgagcgcatcgcgcctgcggtcgca
aaaggcctggcaaaacgtaaagcgcagggcattgataccccgctgaacatcatcgcctgt
gagaacatggtgcgtggcaccacgcagttgaaaggccacgttctggccgccgttgcggac
gaagacaaagcctgggtggaagcgcacgttggcttcgtggattctgccgttgaccgtatc
gttccgccgtcagaatctgcgactaacgacccgctggaagtgacggtggaaaccttcagc
gagtggatcgtggacaaaacccagtttaaaggcgcgttgccgaccattccaggcatggaa
ttaactgataacctgatggcatttgtggaacgtaaactcttcacgctgaacacgggtcat
gctataaccgcgtacctcggaaaattggccggtcatcagactattcgtgatgcgatcctc
gacgagaagatccgcgcggtggtaaaaggggcaatggaagagagcggcgcggtgctgatc
aaacgctacggttttgatgctgataaacacgcagcatacatccagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgttgagcgcgtgggccgccagccattgcgtaaa
ctgagcgcgggcgatcgcctgattaagccgctgctgggcacgctggaatacggcctgccg
cacgccaacctggtgaaagggattgccgccgcgatgcactaccgcagcgagcaggatcca
caggcgcaggagctggctcagttgattgatgaaaaaggcgcgcaggcggcgctggcgcag
atttccggtctggacgccaacagcgatgtggttgcggaggcggttaacgcatataacgca
accaaatga

DBGET integrated database retrieval system