KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_03275Help
Entry
A3UG_03275        CDS       T02159                                 

Definition
(GenBank) bifunctional DNA-binding transcriptional repressor/NMN adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00760  Nicotinate and nicotinamide metabolism
enl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A3UG_03275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:enl03000]
    A3UG_03275
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     A3UG_03275
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     A3UG_03275
Transcription factors [BR:enl03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    A3UG_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like HTH_26 Citrate_ly_lig HTH_35 MMR_HSR1 HTH_37 ABC_tran AAA_29 FAD_syn Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AFM58402
Position
703780..705012
Genome map
AA seq 410 aa AA seqDB search
MSSFDYIKTAIRQKGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RMQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDETRDRQLFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMEEKGIAPNWIYTSEE
SDAPQFREHLGIETVLIDPKRTFMNISGAQIRENPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGMRSLG
SSVDRKEFQTMLVEMLHENNVEFVHVEASDYDTRFLRCVELVKEMMGEQG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatttgactacatcaagaccgcaatccgtcagaaaggctgcacgctacagcag
gtggctgacgccagcggcatgacgaaaggctatcttagccagttgctgaacgccaaaatc
aaaagccccagcgcgcaaaagctggaagcgttacatcgctttctggggcttgaattcccg
cgtatgcaaaagaatatcggcgtggtgtttggtaagttttatccgctgcataccggccat
atctacctgatccagcgtgcctgtagccaggtcgacgagctgcacatcatcatggggtac
gacgaaacccgtgaccgccagctgtttgaagacagcgccatgtcgcagcagccgacggtg
cccgatcgcctgcgctggctgcttcagaccttcaaatatcagaaaaatattcgcattcat
gcctttaatgaagagggcatggagccgtatccacacggctgggacgtgtggagcaacggc
attaaagcgtttatggaagagaagggcattgcgcccaactggatctacacctctgaagag
tccgacgcgccgcagttccgcgagcatctgggtattgaaaccgtgctgatcgatccgaag
cgtacgtttatgaacatcagcggggcgcagatccgcgaaaacccgttccgctactgggat
tacatcccgaccgaagtgaagccgttctttgtgcgcacagttgcgattctgggtggcgaa
tcaagcgggaaatcgacgctggtcaacaagctggcgaacatcttcaataccaccagcgcg
tgggaatacggacgtgattatgtcttttcccatctggggggagacgagatggcgcttcag
tattctgattacgataaaatcgcgctcggtcatgcgcagtacattgatttcgcggtgaaa
tatgccaacaaagtggccttcatcgacaccgattttgtcaccacacaagccttctgtaag
aagtacgaagggcgtgaacacccgttcgtacaggcgctgatcgatgaatatcgcttcgac
ctggtgatcctgctggaaaacaacaccccgtgggtagccgatgggatgcgcagtcttggc
agctctgtggacagaaaagagttccagacgatgctggtggagatgcttcacgagaacaac
gtggagtttgtccacgttgaagcgtcagattacgacacccgtttcctgcgctgcgtcgag
ctggtgaaggagatgatgggggagcaggggtaa

DBGET integrated database retrieval system