KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_03480Help
Entry
A3UG_03480        CDS       T02159                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A3UG_03480 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AFM58443
Position
complement(753752..754129)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSVYVESQSSPDEERFVFAYTVTIRNLGRMPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIDPGEEYQYTSGAVIETPLGTMQGHYEMVDVDGNVFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccaggtacaaagcgtttacgttgaatctcagtcc
tcacccgatgaagagcgctttgtttttgcctacaccgtgaccattcgcaatctggggcgg
atgcctgtgcagctgctcgggcgttactggcttatcactaacggcaatggccgtgaaatc
gaagttcagggtgaaggtgtggttggtgaacagccccacatcgaccctggcgaagagtat
cagtacaccagcggtgcggtgatagaaacgccgctgggaactatgcaaggccattatgaa
atggtcgacgtcgatggcaatgtattccgcgttgcgatccctgtgttccgtctcgccgtt
acaacactcattcattaa

DBGET integrated database retrieval system