KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_11515Help
Entry
A3UG_11515        CDS       T02159                                 

Definition
(GenBank) 3,4-dihydroxybenzoate decarboxylase
  KO
K22958  gallate decarboxylase subunit C [EC:4.1.1.59]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00627  Aminobenzoate degradation
enl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A3UG_11515
Enzymes [BR:enl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.59  gallate decarboxylase
     A3UG_11515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiD
Motif
Other DBs
NCBI-ProteinID: AFM60037
Structure
PDB: 

Position
2492690..2494177
Genome map
AA seq 495 aa AA seqDB search
MQNPINDLRSAIALLQRHQGHYIETDHPVDPNAELAGVYRHIGAGGTVKRPTRTGPAMMF
NSVKGYPGSRILVGMHASRERAALLLGCEPSKLAQHVGQAVKNPVAPVVVPASQAPCQEQ
VFYADDPDFDLRKLLPAPTNTPIDAGPFFCLGLVLASDPEDTSLTDVTIHRLCVQERDEL
SMFLAAGRHIEVFRKKAEAAGKPLPVTINMGLDPAIYIGACFEAPTTPFGYNELGVAGAL
RQQPVELVQGVAVKEKAIARAEIIIEGELLPGVRVREDQHTNTGHAMPEFPGYCGEANPS
LPVIKVKAVTMRNHAILQTLVGPGEEHTTLAGLPTEASIRNAVEEAIPGFLQNVYAHTAG
GGKFLGILQVKKRQPSDEGRQGQAALIALATYSELKNIILVDEDVDIFDSDDILWAMTTR
MQGDVSITNIPGIRGHQLDPSQSPDYSTSIRGNGISCKTVFDCTVPWALKDRFERAPFME
VDPTPWAPELFNDKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccccatcaacgatctcagaagcgccatcgcgttgctgcaacgccatcagggt
cactatatcgaaaccgatcaccccgtagatcccaatgcggaactggcaggcgtgtaccgc
catatcggcgcgggcggtaccgtaaaacgccccacccgcacgggcccggccatgatgttc
aatagcgtgaagggctaccccggctcccgcatcctggtagggatgcacgccagccgggaa
agagcggcactgctgctggggtgcgaaccctcgaagctggcgcagcacgtcggtcaggcg
gtgaaaaacccggttgcgccggtggtggtcccggcctctcaggcaccatgccaggagcag
gtcttctatgccgacgatccggactttgacctgcgtaagctgctcccggccccaaccaac
acgccgattgatgcaggcccgttcttctgtctggggctggtgctggcaagcgatccggaa
gatacctcgctgaccgacgtgaccattcaccgtctctgtgtgcaggagcgagatgaactc
tctatgttccttgccgccggtcgccatatcgaagtctttcgcaagaaggccgaagcggcg
ggcaaaccgctgccggtcaccatcaatatgggacttgacccggctatctacattggggcc
tgtttcgaagcgccaaccacgccattcggttacaacgagcttggcgtcgccggtgcatta
cgccagcagccggtggaactggtacagggtgtggcggtaaaagagaaagcgatcgcgcgg
gcggaaatcatcattgagggcgaactgcttcctggcgtgcgcgtaagagaagatcagcac
accaacaccggccacgccatgccggagttcccgggctactgcggtgaagccaacccgtcc
ttaccggttatcaaagtgaaagcggtcaccatgcgaaaccacgcgatcctgcagacgctg
gtgggcccgggcgaagagcacaccacgctggccggtttgccgacagaggccagcattcgc
aacgcggtcgaagaggccatccctggttttctgcagaacgtctacgcacacaccgccggg
ggcggtaaattcctcggcattttacaggtgaaaaaacgccagccctcagacgaaggacgt
cagggccaggcggcgcttatcgccttagccacctattccgagctgaaaaacattatcctc
gtggatgaagacgtggacatcttcgacagtgacgacatcctgtgggcgatgaccacccgt
atgcagggcgatgtgagcatcaccaacattccggggatccgtggccaccaactggatccg
tcgcagtcgccggactacagcacctcgatccgaggaaacggcatttcctgcaagactgtc
ttcgactgcacggtaccgtgggcgctaaaggaccgctttgaacgtgcgccgtttatggaa
gttgatcccactccatgggcaccggaactgttcaacgataaaaaataa

DBGET integrated database retrieval system