KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_11575Help
Entry
A3UG_11575        CDS       T02159                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00052  Galactose metabolism
enl00500  Starch and sucrose metabolism
enl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3UG_11575
   00500 Starch and sucrose metabolism
    A3UG_11575
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A3UG_11575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AFM60047
Position
complement(2504339..2505745)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAVLQAVMKGQPRARADRHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCDHRYKCWGHWSSDDLLHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFKKLGPVLALPDGYTGHVRDPKVWQHDGMWYMVLGAQDVQ
KRGKVLLFRSADLHTWVLCGEIAGHGVNGLTEAGYMWECPDLFALDGTHVMICCPQGLAR
EPHRYLNTYPAAWMSGAFDYQRGAFEHGALHELDAGFEFYAPQTTLAEDGRRILMGWMGV
PDGEEMLQPTRSQGWIHQMTCPRELRYRDGKLWQTPVRELEALREEEQHWQGNACDAPVL
DASRLEFELSAASSKLDFAGALHLTVDGNGLRLERASLKTGETLTRYWLGEVHHLRVLCD
HSSVEIFINHGEGVMSSRYFPDQPARVRFEGASDITLRYWSLRACMVE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacattaccttcccgctggcctgccgtgctgcaggctgtcatgaaagggcaaccgcgc
gcgcgcgccgaccgccactatccgcagtggcatccggcgccggtgacggggctgatgaac
gatccgaacggttttatctggtttgccgggcgttaccatctgttttatcagtggaacccg
ctggactgcgatcaccgctataaatgctgggggcactggagttcggacgatctgctgcac
tggcagcacgagcccatggcgctgatgccagatgaagagtacgaccgcaacggttgctat
tccggcagcgccgtggacaacaacggggtgctgacgctgtgctataccggcaacgtgaag
ttcgatgacggcagccgcaccgcctggcagtgcctggccgtggaacaaccggacgggacc
tttaaaaagctggggccggtgctcgcgctgccggatggctacaccggccacgtgcgcgat
ccgaaggtgtggcagcacgacgggatgtggtacatggtgctcggcgcgcaggatgtgcaa
aagcgcggcaaagtgctgctgttcaggtctgccgatttgcacacgtgggtattgtgcgga
gaaatcgccggtcacggcgtcaacggactgacggaggcgggatacatgtgggagtgcccg
gacctgtttgccctcgacgggacgcacgttatgatctgctgcccgcaggggctggcgcgt
gagccgcatcgttacctgaacacctatccggcagcctggatgagcggggcgtttgactat
cagcgcggcgcatttgagcacggtgcgttacacgagctggacgccggttttgagttttac
gccccgcaaacgacgctggcggaagatggccgacggatcctgatgggctggatgggcgtg
cctgacggggaagagatgctgcagcccacccggtcacagggctggatccatcagatgacc
tgcccgcgagagctgcgctaccgcgacggcaagctctggcagaccccggtgcgtgagctg
gaagcgctgcgcgaagaggagcagcactggcagggcaacgcctgcgatgcgccggtgctt
gatgcctcgcgccttgagttcgagctgagtgcagcctcctcgaaactggattttgccggt
gcgctgcacctcacggtcgatggcaatggcctgcgtctggaacgtgccagcctgaaaacg
ggtgagacgttaacccgctactggctgggtgaggttcaccatctgcgcgttctgtgcgac
cactccagcgtcgaaattttcatcaaccacggtgaaggggtgatgagcagccgctatttt
cctgaccaaccggcccgggtgcgattcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcgcctgcatggtagaatag

DBGET integrated database retrieval system