KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13310
Entry
A3UG_13310        CDS       T02159                                 

Definition
(GenBank) hypothetical protein
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
SSDB
Motif
Pfam: RHS_repeat PAAR_motif RHS DUF4150
Other DBs
NCBI-ProteinID: AFM60390
Position
complement(2861707..2866098)
AA seq 1463 aa
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGLAATAAAPLLGAGAAAAGVA
AIGSSCLLSGIVGGVLANLAGVTDDISNIAEGLGDALFPPSPAGKITTGSSNVLTNSLPA
ARAAGTLTPADTPPPEPQSPGSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDK
VACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTVSDDVSPNVIIGGETLTVRDIK
SGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATG
VKVLNDDDELDFSLPGRFPLRWQRSYNSLTSREGLFGLGWATTFDSYLTLEESNATWFDE
TGRELSFELPPVDRAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRVNPSVLRLAS
LSDEYGNALLTEWDEHGRLVGLHDEPRAIDVTLRYEDERFPQRVTAASHFDGSRSWPLMQ
WGYDARGQLASATDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWKKLDHWRVVENRTS
TGDGCRFTYDLDAGLTTVEHYDGQKRQHYWNAQNLIVRYVDERGENWRYAWDDNELLTQR
IDPLGNAVTFVYDEMGNRVQEIDPDGNARTTTWLEHRGLPTAIIEADGSATRFWYDEHHG
LKRVVDPMGQTTLLRRDEFGLVVEEVDAAGNSRHQEYNEAGQVVRATDCSGRTTRYHYHP
LGWLMIETGADGEETRYRYDAAGRPVQLDRPEGWTESLTWNKRGLPVKHAGADGKESEFR
YDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGPDSHLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLTRIGL
HPALSADAWSTEAEQELSFEYDALGRVTREAGEHGELAWQYDALGNRTSVTLPDGRELKQ
FYYGSGHLLSIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQ
RPSPRRWTRRWDYDYRNNLVREERDDNPFSWYRWQYDSAGRLLVQDGTLPGQEQWRWDAA
GNPLDGSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQTRWHYRYDGEHRLTEVISQPR
DRNRPQTQVSFRYDPLGRRISKTRQQMLGGQPTGKPVTTRFVWEGFRLLQELHGDVPLTY
VYSNQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESE
TQLSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYAPNAL
GWVDPFGLSNLALPAPTSLDPWGSDAILHSMPVPKGGITVEMAMSPGQTQPGGWATVDHI
PDVDYVRMKLAVIPEFKSDISHVQRFHIPEGVQIQVGPVGPQTSGGKIYPGGGSQIQILN
YLDRAKLVPVGPPRKISSRTCGK
NT seq 4392 nt   +upstreamnt  +downstreamnt
atgagcgataacaacgcggcccgcaagggtgacgagattattcactccagcattttcgcg
gatatcaccagcattgtggcggaaggtgccgcctatgcggtgatcggcgcggcggtaggg
ctggcagcaactgccgccgcacctctgctgggggcgggggcagccgctgcgggcgtggcg
gcgattggctccagctgcctgttaagcgggatcgtcggtggcgtactggctaacctggcg
ggtgttactgacgatatcagtaatatcgcggaggggctgggggatgcgctgttcccgccg
tcacccgcaggtaaaatcaccaccggctccagcaatgtgctcaccaacagccttcccgct
gcacgcgcggccggaacgctgacccccgcagatactccacccccggagccacagtcaccg
ggtagttttgccgattacgcgggcatgttgctctccgctgccggacagttcggcagtgaa
atgtggcagccgagcgtggcctccgctgcggcgggtacatcgccgctggaagaggataag
gtcgcgtgtgaaaaacactccggaccgcagtatctggcggaaggctctaaaagcgtcttt
atcaatggacaaccggcagtacgtgccaaagatcgcaccacctgcgaagggaccgtttcc
gacgacgtttccccgaatgtgatcatcggcggcgagacgctgacggttcgcgatatcaag
agcggcaaaacgccggggctggcactggggatgattgcgctctccctgctgcgcggccgt
ccgggcaagattttgaagaacatgccctgcgcgctggcggccgcgggtggcgggatgctg
gccgatatggccgtcaatgccgtatttggctcctcgcacccggttcatgccgccaccggc
gtgaaggtgctgaatgacgatgatgagctcgatttctcgctgcccgggcgttttccgctt
cgctggcagcgcagctataacagcctgacctcccgcgaagggttgtttggcctgggctgg
gcaacaacctttgacagttatctgacgcttgaagagagcaatgccacctggttcgacgaa
accgggcgtgagctgagctttgaactgccacccgtcgaccgcgcgttctacagcatcagc
gagggtatcatcatccgccgcaacgagagcggtgatgtggcgattgccgacgatgacggc
gcggtgtggcgcctgtataaaccgacacgcgtgaatccatccgttctgcgtctggcctcc
cttagcgacgaatacggcaacgcactgctgacggagtgggatgagcacggcaggctggtc
ggtctgcacgatgagccgcgggcaatagacgtcaccctgcgctatgaggacgaacggttc
ccgcagcgcgtaaccgctgccagccattttgacggcagccgtagctggccgctgatgcaa
tggggttacgatgcgcgtggccagctggcgagcgcgacggatgcctctggcgtcgtcacc
cgcgaataccgttataacgaccatggtctgatggtctggcatcgtctgccgggcgggctg
gaaagtgaataccgctggaaaaaattagaccactggcgcgtggttgaaaaccgcaccagc
accggggatggctgtcgtttcacctacgatctggacgccgggttgaccaccgtcgaacac
tacgatggtcagaaacgtcagcactactggaacgcgcaaaatctgatcgtccgctacgtt
gacgagcgcggcgagaactggcgctacgcgtgggatgacaacgagctcctcacgcaacgc
atcgatccgctcgggaacgccgtcaccttcgtttacgacgagatgggcaaccgggtgcag
gagatcgaccctgacggcaatgcccgcaccacgacctggcttgaacaccgcgggctaccg
acggccatcattgaagccgacggcagcgctacccggttctggtacgacgaacatcacggc
ctgaagcgcgtggtggacccaatggggcagaccacgctgctgcgccgggacgagtttggt
ctggtcgttgaagaggtggatgccgccggaaacagccgccatcaggagtacaacgaagcg
ggacaagtggtgcgtgcgacagactgctctggccgcaccacccgctatcactatcatccg
ctgggctggttgatgatcgagacgggcgccgacggcgaagagacgcgttatcgctacgac
gctgccgggcggccggtgcagctcgatcgcccggaaggctggacagagtcgcttacatgg
aacaaacgtggcctgccagtgaagcatgctggcgctgacggtaaagaaagtgagttcaga
tacgatgaggccggacgcttaaccgccacgcgtaatacgcagggtgaggaagttcgtcgc
cgctgggacagcagagggcgtctgattgcccttgaaaatgaaaacggcgaagcgtatcag
ttccgctgggggcctgactcgcacttgctggaggaggtggggcttgatggtgtggcctcg
cagtatcgctacgacgcctgtgggcgcacgatagcgcgcacctttgctgccggtcatccg
gaggccatcacccacgcctttgcctggagcgcgagcgggcaactggtcgcccgcactacg
ccggaagggcagacccgctaccactataccccgtcagggctgctgacccggattgggctg
cacccggcgctttcagccgacgcgtggagtaccgaggccgagcaggagctttcctttgag
tatgacgcacttggtcgcgtgacccgcgaagcgggcgagcacggtgagctggcgtggcag
tatgatgcccttggcaaccgcacctccgttacgctgccggatggccgcgaactcaaacag
ttctactacggcagcgggcatctgctcagcattgcccttgataagctgtcggtatccgac
tttacccgcgacgaactccaccgggagaccagccgcacgcagggcctgctcaccacccgc
agcgaatacgaccgtttaggtcgccttcatcgccgggatgtcttcaccggcaacgcacag
cgcccgtcaccacgccgctggacccgccgctgggattatgactaccgcaataatctggtg
cgggaagaacgggacgataacccgttcagctggtaccgctggcagtacgacagcgccggg
cgcctgctggttcaggacggcacgctgcccgggcaggagcagtggcgctgggatgcggcc
ggtaacccgctcgacggctctgctgagaaggtcacgcacaaccgcctgacgcagctgaat
ggcattcgctggcgttatgacatccacggccgcaccgtggagaaggataacggccagacc
cgctggcactaccggtacgacggtgaacaccgcctgacggaagtgatcagccagccgcgg
gatcgcaacaggccacagacgcaggtcagcttccgctacgatccgctcgggcgacgcatc
agcaaaacgcgccagcagatgctgggcggacagccaaccggtaagcccgtcaccacccgg
tttgtctgggaagggttccgcctgctgcaggagctgcacggagatgtaccgctgacctat
gtctacagcaatcaggacagctatgatccgctggcacgtattgacggcgttgatgctccg
gagattttctggttccactgccagccgaacggcacgccggaacggatgacggatattgaa
gggcaggtgcgctgggaaggcgttaacagcgcctggggcaagctgctacgggaaagcgag
acgcagctatcaggatattcccagaacctgcggatgcaggggcaatacctggatcgtgag
acagggctgcactacaatctgttccggtattacgacccggactgcgggcggtttacgcag
caggacccgatagggttggcgggagggataaatctttaccagtatgcaccgaatgcgctg
gggtgggtggatccatttggtttaagtaacttagcattacctgctcccacctcccttgat
ccatggggaagcgatgctattttacactctatgccagttcctaaaggtggaattactgtt
gaaatggcaatgtctccaggccaaactcaacctggaggatgggctaccgttgatcacatc
ccagatgtcgactatgtcagaatgaaattagctgttatacctgagtttaaatcagatata
tctcatgtccaaagattccatatacctgagggcgtgcaaattcaggtcggcccggttggg
ccgcagacttctggaggaaaaatatatccaggagggggatctcaaattcaaatccttaac
tatttggatcgagctaaacttgtgccagtcggcccacccagaaaaatctcatcaagaaca
tgtggtaaataa

DBGET integrated database retrieval system