KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13465
Entry
A3UG_13465        CDS       T02159                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enl02044]
    A3UG_13465
Secretion system [BR:enl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A3UG_13465
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFM60419
Position
complement(2894798..2895322)
AA seq 174 aa
MAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLPAVDER
KFLEIDIDNFDERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARKVEPLN
KLLEARTQLSNLLTYMDGKNGAEELIAKILQDPTLLKSLSQLPKNDESAKGSEE
NT seq 525 nt   +upstreamnt  +downstreamnt
atggcaatgagtaacagtgggcagaaatttatcgcacgtaaccgtgccccccgcgtgcag
atcgagtacgacgtagagatctacggtgcagaacgtaaaattcagctgccgttcgtgatg
ggcgttatggccgatctggtcggcaaaccggtggaaaatctgccggccgtcgatgagcgt
aaattcctcgaaatcgacatcgataactttgacgaacgcatgaaggcgcttaagccgcgc
gtggcgttccaggtggacaacaccctgaccggcgaaggcaagctcaacgtcgatctgacc
ttcgacagcatggacgacttcctgccggatgcggtggcccgcaaggttgaaccgctgaac
aagctgctggaagcgcgtactcagctttccaatctgctgacctacatggacggtaaaaac
ggcgcggaagagctgatcgctaaaattctgcaggatccgacgctgctcaaatccctgagc
cagttgccgaaaaatgacgaaagtgcgaaaggtagcgaggagtaa

DBGET integrated database retrieval system