KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13490
Entry
A3UG_13490        CDS       T02159                                 

Definition
(GenBank) type VI secretion system protein ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enl02044]
    A3UG_13490
Secretion system [BR:enl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A3UG_13490
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFM60424
Position
complement(2902038..2903381)
AA seq 447 aa
MSKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDEAMLRQGCI
ALSYCSGVLPDGTFFQVRNGRNGPAPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPAS
LARFIAFEQEVEDDNAMSVGDATVQFGRLRLTLMLEKDLTAEWTAIGIAFVAEKRNDNHV
RLDSSYIPPMLNACNSPQLYSMVNDLHGLLVQRSQQIGGRLRQPGRFNTSELIEFTLLSL
VNRHLGEVSHLKTLPLLHPETLWRSWLPFATELATWTSQRTAESVLPIYDHDDLAGCFSK
LMLMLRQGLSLVMEDQAIQLPLNERSHGLNIATVPETSMVREFGFVLAVKANVPGEHLQT
HFPAQMKVAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELEKGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagcaaagcagagaaggtcgtctggaccgaaggcatgttcctgcgtccacaccatttt
caacggacagaaagttatctgctcaaccacgttcgggaatggggtgcgctgcagcgatcg
tatctctggggcttcctcgatgttgaactggacgaagcgatgcttcgccaggggtgcatt
gccctgagctactgcagcggtgtgctgccagacggcacctttttccaggttcgcaacggg
cgtaacggcccggcccccctgaaaattcctgacaatctcaccaatgaaaaggtggtgctc
gcgctgccggtacgtcggggagagcgtgaagaggttattttcagcgaggagcccgcgtca
ctggcgcgtttcatcgccttcgagcaggaggtggaagacgataacgccatgtcggtgggg
gatgctacggtgcagtttggccgtttacgtctgaccctgatgctggaaaaagatctgacg
gccgaatggacggcgattggcatcgcgttcgtcgcggaaaagcgtaacgacaaccatgtg
cgtctggatagcagctacattccgccgatgctgaacgcctgcaacagcccgcaactctac
agcatggtaaacgatctgcacggcttgctggtgcaacgtagccagcagattggtggtcgt
ctgcgccagcctggccgctttaacacctccgagctgatcgaatttacgctgctgtcgctg
gttaaccgtcacctgggcgaagtctcccatttaaaaacgctcccgctgctgcacccggaa
acactctggcgcagctggctgccgtttgccacggagcttgccacctggacctcgcaacgc
accgccgaaagcgtgctgccgatttacgatcacgacgaccttgcgggatgcttcagcaag
ctgatgctgatgctgcgtcaggggctgtcgctggtgatggaagatcaggccattcagctg
ccgctgaacgagcgctcccatgggctgaacatcgccacggtaccggagaccagcatggtg
cgcgagttcggcttcgtcctggcagtcaaagccaacgtgccgggcgagcacctgcaaacc
catttccctgcccagatgaaagtcgcgccggtgtcgaaaatccgcgatctggttcagtta
cagctgccgggcattatgctgcgcgccatgccggttgcgccgccgcagatcccatggcat
gcgggctacagctactttgagctggagaagggcagtgagctgtggcacgagatggataag
tccggtgcattcgccctgcatctcgcaggggagttcccgggtcttgatatggagttttgg
gccatccgtagcccgactgaataa

DBGET integrated database retrieval system