KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13740Help
Entry
A3UG_13740        CDS       T02159                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:enl03009]
    A3UG_13740 (rrmA)
Enzymes [BR:enl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A3UG_13740 (rrmA)
Ribosome biogenesis [BR:enl03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    A3UG_13740 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_31 Methyltransf_25 Methyltransf_23 Ubie_methyltran Methyltransf_12 Methyltransf_32 MTS PCMT MetW Methyltransf_29 CMAS Methyltransf_4 Methyltransf_9 Pox_MCEL PrmA
Motif
Other DBs
NCBI-ProteinID: AFM60474
Position
complement(2956135..2956950)
Genome map
AA seq 271 aa AA seqDB search
MPFSCPLCHARLTRSEKSYACPQGHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRETVAQLLGENLADNASALLDIGCGEGYYTARFAEIAREKGAQTMGLDVS
KVAIRAAAKRYAAVMFCVASSHRLPFDDASMDAVVRIYAPCKAEELARVVKPGGWVITVT
PGPRHLMELKGLIYDDVRLHAPHSEQLAGFVLRQEHTVAYEMDLKGNEAVALLQMTPFAW
RAKPAVWETLAAHSTFRCQTDFSIHCWQRED
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcagttgccccctttgccacgcgcgcctgacgcgttctgagaaaagttatgcg
tgtccgcagggacatcagtttgatatggcgaaagaagggtatgtgaatcttctgccggtg
cagcataaacgctcccgcgatccgggcgacagcgctgaaatgatgcaggcgcgccgcgca
tttctggatgccgggcactatcagccactccgggaaaccgtcgcgcagctgctcggtgaa
aatctcgcggataatgcgtcggctttgctggatatcggctgcggggaagggtattacacc
gcaaggtttgcggagattgcgcgcgagaagggcgctcaaacgatggggctggatgtgtcg
aaagtggcgattcgcgccgcggctaaacgctatgcggcggtgatgttctgtgtggcatcg
agccaccggctgccgtttgatgatgccagcatggatgccgtcgtgcgtatttatgctccc
tgcaaggcagaggaactggcgcgggtggtgaaacccggtggatgggtgataaccgtcacg
cctggcccacgtcacctgatggagctgaaagggctgatttatgacgatgttcgcctgcat
gccccccattcagaacaattggctggttttgtgctcaggcaggaacataccgtcgcgtat
gagatggacctgaaagggaatgaggccgtggcgttgctgcaaatgacgccgtttgcatgg
cgggcaaaaccggctgtgtgggagacgttggcggcgcactcaacatttcgctgccagacg
gatttcagcatccactgctggcagcgcgaagattaa

DBGET integrated database retrieval system