KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13900Help
Entry
A3UG_13900        CDS       T02159                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00030  Pentose phosphate pathway
enl00480  Glutathione metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
Module
enl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
enl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
enl_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3UG_13900
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A3UG_13900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enl04147]
    A3UG_13900
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A3UG_13900
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A3UG_13900
Exosome [BR:enl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A3UG_13900
  Exosomal proteins of colorectal cancer cells
   A3UG_13900
  Exosomal proteins of bladder cancer cells
   A3UG_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFM60506
Position
complement(2989377..2990852)
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLHPDTRILGVGRADWDKDAYTK
VVREALETFMKEKIDESLWDTLSGRLDFCNLDVNDVSAFTRLGEMLDQKNRVTINYFAMP
PSTFGAICKGLGEANLNAKPARVVMEKPLGTSLSTSREINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQVLCMIAMSPPSDLTADSIRDAKVKVLKSLRRIDRSNVREKTVRGQYTSGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDDWRWAGVPFYLRTGKRLPAKCSEVVVYFKNPELNLF
KESWQELPQNKLTIRLQPDEGVDIQILNKVPGLDHKHNLQTTKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADQDPPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcatgtgacctggtcattttcggcgcgaaaggcgat
cttgcacgccgaaaattgctgccttccctgtatcaactggagaaagcgggccaacttcat
ccggatacccgtatcctgggtgtagggcgcgccgactgggacaaggacgcatataccaaa
gtcgtgcgtgaagcgctcgaaacgttcatgaaagagaaaattgatgaaagtttgtgggat
accctgagcggacgtctcgatttctgcaatctggatgtgaacgacgtgagcgcgtttacc
cgtctgggtgagatgctggatcagaaaaaccgggtcaccattaactatttcgccatgcca
ccaagcacctttggcgccatctgtaaaggtctgggcgaagcgaatctgaacgccaaaccg
gcgcgtgtggtaatggaaaaaccgctgggtacctcgctgtctacctcccgcgaaatcaac
gaccaggtgggcgaatacttcgaagagtgccaggtctaccgcatcgaccactatctgggc
aaagagacggtactgaacctgctggcgttgcgttttgccaactccctgtttgttaacaac
tgggacaaccgtaccatcgaccacgtggaaatcaccgtggccgaagaggtgggtatcgaa
ggtcgctggggttactttgaccaggccggccaaatgcgtgacatgatccagaaccacctg
ctgcaggtactctgcatgatcgctatgtctccgccatcagacctgaccgcagacagcatc
cgcgacgcgaaagtgaaagtcctgaaatcactgcgccgtatcgaccgttctaacgtgcgt
gagaagacggtgcgtggccagtacacctccgggtttgcgcagggcaaaaaagtccctggc
tatctcgaagaagagggcgcgaacaagtccagcaacaccgagacttttgtggcgatccgc
gtggatatcgatgactggcgttgggcgggtgtgcctttctacctccgcaccggtaagcgt
ttgccagccaaatgctctgaagtcgtcgtctacttcaaaaaccctgagctgaatctgttt
aaagagtcctggcaggagctgcctcagaacaaactgactatccgtctgcagccggatgaa
ggtgtggatatccagatcctgaacaaagtaccggggctggatcacaagcacaacctgcag
accaccaaactggatctgagctactccgagaccttcaatcaaacgcacctggcggatgct
tacgagcgcctgctgctggaaaccatgcgcggtatccaggcgctgtttgtacgtcgcgac
gaagtggaagaggcgtggaaatgggtcgactccatcaccgaagcctgggctgccgatcag
gatccgccaaaaccgtatcaggcgggcacctggggacctgtcgcctccgtggcgatgatc
acccgtgatggccgctcctggaacgagtttgagtaa

DBGET integrated database retrieval system