KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_14245
Entry
A3UG_14245        CDS       T02159                                 

Definition
(GenBank) type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:enl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A3UG_14245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enl02044]
    A3UG_14245
Secretion system [BR:enl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A3UG_14245
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFM60575
Position
3058632..3059123
AA seq 163 aa
MAIPAYLWLKDDGGADIKGSVDILDREGSIEVLSFSHGLLVPTDNGTGKITGTRLHAPLV
IEKEFDSSSPYLYKAVATGQTLKSAEIKWYKINDAGQEVEYFNMLLENVRVVSINPVMHN
CKEPALQIHNHNEGIQLRYERITWKYCDGNVQYSDAWNERVTV
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctattcctgcttacttatggcttaaggatgacggtggtgcggatatcaaaggatct
gttgatattttagatcgtgaagggagtattgaagtgctttcatttagtcacggcttattg
gttccgaccgataacgggacgggcaaaataaccggtacgcgcctccatgcgcctctcgta
atcgaaaaagagtttgatagctcgagtccgtacctctacaaagcggtagcaacaggccag
acgctaaaaagcgcagagataaaatggtataaaatcaacgatgcaggacaagaagttgaa
tacttcaatatgttgcttgaaaacgtccgggtagtcagtattaaccccgttatgcataac
tgcaaagagccagcattacagatacacaatcacaacgaaggtatacagctccgctatgag
cgtatcacctggaagtactgcgacgggaatgtccaatactcggacgcatggaacgagcgc
gttacagtctaa

DBGET integrated database retrieval system