KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_16170Help
Entry
A3UG_16170        CDS       T02159                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:enl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A3UG_16170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enl02000]
    A3UG_16170
Transporters [BR:enl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    A3UG_16170
   Histidine transporter
    A3UG_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 SARS_lipid_bind DUF872
Motif
Other DBs
NCBI-ProteinID: AFM60960
Position
complement(3480641..3481327)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGALVTLELAISSVVLAVLIGLAGAGAKLSANKPLALIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNSVTDAMGMGQIDIDPMVAGIITLGFIYGAYFTETFRGAYMAVP
KGHIEAATAFGFTSSQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGVIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacggattttctggcgttattttacagggcgcgcttgttacccttgagctggct
atcagctccgtggtgctggcggtgctgataggtctggcaggcgcaggggcgaagctttcg
gctaataaaccgctggcgctgatttttgaaggctataccacgctgattcgcggtgttcct
gacctggtactgatgctgctcattttttacgggctgcagatcgcgctgaacagcgtgacg
gacgccatggggatgggacaaatcgatatcgacccgatggtggccggtattattaccctc
ggttttatctacggcgcgtacttcaccgaaaccttccgcggcgcttatatggcggtcccg
aaaggacacatagaagcggccaccgcatttggttttacctcctctcagacgtttcgtcgg
atcatgttcccggccatgatgcgctacgcgcttccgggcattggcaacaactggcaggtt
atcctgaaggccacggcgctggtctctctgctgggtctggaagatgtagtaaaggccacg
cagcttgccggcaaaagtacctgggagccgttctactttgcggtggtgtgtggcgtgatc
tatctggtctttacgactgtctccaatggtgtgctgcttctgctcgaacgtcgctactcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system