KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_0291Help
Entry
EBS_0291          CDS       T04530                                 

Gene name
coaC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00770  Pantothenate and CoA biosynthesis
enm01100  Metabolic pathways
Module
enm_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EBS_0291 (coaC)
Enzymes [BR:enm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     EBS_0291 (coaC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     EBS_0291 (coaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC
Motif
Other DBs
NCBI-ProteinID: BAN68271
UniProt: S6BGP4
Position
317579..318805
Genome map
AA seq 408 aa AA seqDB search
MSNHFRLCARRILLGVTGGIAAYKAAELARLLVRAGAEVQVVMTEAAGAFIGELTFQAIT
GRPVRQALFDPTHEAAMGHIELARWAELILVVPASADFLARLHAGLADDLLSTLCLASEA
PLAVAPAMNQNMWRHPATTANVEALCARGVRVWGPAEGEQACGDQGPGRLLEPAELLARV
GELFGRGRLGGRKAVVTAGPTREPLDPVRFLGNRSSGKMGYAVAEALLREGAEVILVSGP
VSLAAPPGVRLVPVETALAMREAVLEAVAGADLFVACAAVADYRPREVADHKIKKTEETL
QVGLVKNPDILREVAALPDRPFCVGFAAETEALAGQAEAKRQAKGIDMIAANQVGEGEGF
EVDDNALLVLWEGGRLELPRQPKTRLAERLVSVIAERMDAQATIEDPR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatcactttcgactgtgtgcccggcgcatcctgctgggcgtgaccgggggcatc
gccgcctacaaggccgccgagctggcgcgtctgctggtgcgtgccggggccgaggttcag
gtggtgatgaccgaggcggcgggcgccttcatcggcgaactgaccttccaggcgatcacg
gggcggccggtgcgtcaggcgctgttcgatcccacgcacgaggcggccatgggacacatc
gagctggcgcgctgggccgagctgatcctggtggtgccggcgagtgccgacttcctggca
cgcctgcacgccggcctggccgacgatctgctgtccaccctgtgcctggccagcgaggcg
ccgctggcggtggcgccggccatgaaccagaatatgtggagacacccggcgacgaccgcc
aacgtcgaggccttgtgcgcacgcggcgtgcgggtctgggggccggccgagggagagcag
gcctgcggcgaccaggggccgggtcgcctgctcgaaccggccgagctgctggcacgggtc
ggcgagctgttcgggcgggggcgcctgggtgggcgcaaggcggtggtcaccgccggtccc
acacgcgaaccgctcgatccggtacgctttctcggcaaccggagttcgggcaagatgggc
tatgcggtggccgaggccctgctgcgcgagggggcggaagtgatcctggtcagtggtccg
gtgagcctggctgcgccgccgggggtgcgccttgtcccggtggagacggcgctggcgatg
cgcgaggccgtactcgaggcggtggccggggccgatctgttcgtggcctgcgcggcggtc
gccgactatcgtccgcgcgaggtggcggaccacaagataaagaagaccgaagagaccttg
caggtcgggctggtgaaaaatcccgatatcctgcgtgaagtggcggccctgccggatcgt
cccttctgcgtgggctttgccgcggagaccgaggcgctggccgggcaggcggaagccaag
cggcaggccaaggggatcgacatgatcgccgccaaccaggttggcgagggcgaagggttc
gaggtcgacgacaatgcgctgctggtgctctgggaagggggacgtctcgaactaccccgg
cagccgaaaacccgactggccgagcgactggtctcggtgattgcggagaggatggatgca
caggctacaattgaagatcctcgatga

DBGET integrated database retrieval system